tag:blogger.com,1999:blog-27519499498226081522024-03-05T07:34:39.099-08:00Maruti Stotra Blog Collection of Hindu Stotras and Mantras.Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.comBlogger29125tag:blogger.com,1999:blog-2751949949822608152.post-39573277260810683412017-11-09T22:33:00.001-08:002017-11-10T00:03:20.935-08:00Significance of Puja Thali<div dir="ltr" style="text-align: left;" trbidi="on">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgbJeK3L1TXgD5gjiJGWsyNMPbgKawJObzIgJqXfjD92Xi6S7XlyGjHu-6JFrFUToBXT20k2CCLa67MbLEI7BRFS8tFduzUjWWrcJZw5bEciIGiVDhvzsiSs02KtwHydVF3yBdOsl4pvCY/s1600/puja+thali1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="726" data-original-width="620" height="320" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgbJeK3L1TXgD5gjiJGWsyNMPbgKawJObzIgJqXfjD92Xi6S7XlyGjHu-6JFrFUToBXT20k2CCLa67MbLEI7BRFS8tFduzUjWWrcJZw5bEciIGiVDhvzsiSs02KtwHydVF3yBdOsl4pvCY/s320/puja+thali1.jpg" width="273" /></a></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
In Hindu Dharma, there are many ways to worship the divine God.If anyone follows the path of Kamakanda then the person has to maintain the spiritual significance attached to it.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
In Hindu religion , we do Puja of any God or deity or Saint.Puja Thali has special significance while doing any ritual acitivity.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Puja thali is a tray or a big container in which the entire puja materials are decorated.Puja Thali generally available of different metals and you can also decorate your puja thali in the way you like.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Before starting the actual puja it is important that people accumulate all kind of puja samagris that is used in any puja.</div>
<div style="text-align: justify;">
<br /></div>
<h2 style="text-align: justify;">
Significance of Puja Thali</h2>
<div style="text-align: justify;">
It is said that the elements in the puja thali mustrepresents five cosmic elements. The elements are Earth or Prithvi, Holy Water, Fire or Tej, Wind or Vayu and Ether or Akash.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
These cosmic elements are chosen because they are considered to be the most important essentials that balance the entire universe. These elements help the worshipper to get the maximum blessing from the deity who is worshiped.</div>
<div style="text-align: justify;">
<br /></div>
<h2 style="text-align: justify;">
Main Contents of Puja Thali </h2>
<div style="text-align: justify;">
Like Haldi-kumkum,agarbatti,diya,money,cloth depending upon culture.In India, as many religion and many language people stay together.They have differences in their landuage,caste,color,traditions,way of living and many more.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
But Puja Thali is common while doing any spiritual thing.In Puja thali they may kept different thigs depending upon their culture.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
</div>
<ul>
<li>Turmeric /Sindoor paste for holy symbols like 'Om', 'Swastika' etc.</li>
<li>Akshata (unbroken rice grains).</li>
<li>Diyas and incense sticks(Agarbatti).</li>
<li>Coconut.</li>
<li>Flowers (marigold, rose)</li>
<li>Indian sweets for Prasad.</li>
<li>Holy water in a container.</li>
</ul>
<br />
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>The contents may change as per festival like</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
In Diwali occasion, more than one diya might be arranged on thali; </div>
<div style="text-align: justify;">
In Rakshabandhan, one rakhi is needed. </div>
<div style="text-align: justify;">
In Shivaratri,Bael-leaves are kept.</div>
<div style="text-align: justify;">
In Birthday, we do Puja of Birthday Boy/girl for their long life</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Thus in different occasions and festivals, puja thali decoration varies with importance of the rites.</div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com2tag:blogger.com,1999:blog-2751949949822608152.post-86754351130755215522017-11-09T20:34:00.003-08:002017-11-09T20:45:14.267-08:00108 Names of Shree Ganesha<div dir="ltr" style="text-align: left;" trbidi="on">
<h2 style="text-align: center;">
108 Names of Shree Ganesha</h2>
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiWaRIU17tZUR6GWN_yLBIG9sndP3785miJONMITW7Ta5LTB1kpW9C323VxpBvZFbW1xJ7oh_ofLWBGS0eJptfBn4c3dqArg6t7VtZK6o28GmoeTSZW7U9VI1VdJj0QRs1Ra-taC_uuz6k/s1600/ganesha2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="621" data-original-width="544" height="320" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiWaRIU17tZUR6GWN_yLBIG9sndP3785miJONMITW7Ta5LTB1kpW9C323VxpBvZFbW1xJ7oh_ofLWBGS0eJptfBn4c3dqArg6t7VtZK6o28GmoeTSZW7U9VI1VdJj0QRs1Ra-taC_uuz6k/s320/ganesha2.jpg" width="280" /></a></div>
<br />
<br />
<div style="text-align: justify;">
108 number in Hindu religions has significance.It is common practice to do Japa or mantra of any deity 108 times.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Hindus use 108 names of Lord Ganesha to describe the multitude of his impressive characteristics and powers.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Recital of this list is used to invoke the blessings of the Ganesha. It is to be noted that this list of 108 Names of Lord Ganesha can be recited in any order.</div>
<div style="text-align: justify;">
<br /></div>
<h2 style="text-align: left;">
Following is the list of all 108 names of Shree Ganesha</h2>
<br />
<table border="0" cellpadding="0" cellspacing="0" style="border-collapse: collapse; border-spacing: 1px; width: 441px;">
<colgroup><col style="width: 48pt;" width="64"></col>
<col style="mso-width-alt: 5741; mso-width-source: userset; width: 118pt;" width="157"></col>
<col style="mso-width-alt: 8045; mso-width-source: userset; width: 165pt;" width="220"></col>
</colgroup><tbody>
<tr height="29" style="border-spacing: 1px; height: 21.75pt; mso-height-source: userset;">
<td class="xl65" height="29" style="border-spacing: 1px; height: 21.75pt; width: 48pt;" width="64">1</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; width: 118pt;" width="157">ॐ
विनायकाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; width: 165pt;" width="220">Om
Vinayakaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">2</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ विघ्नराजाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Vighnarajaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">3</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ गौरीपुत्राय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Gauriputraya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">4</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ गणेश्वराय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Ganeshwaraya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">5</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ स्कन्दाग्रजाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Skandagrajaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">6</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ अव्ययाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Avyayaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">7</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ पूताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Putaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">8</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ दक्षाध्यक्ष्याय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Dakshadhyakshyaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">9</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ द्विजप्रियाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Dwijapriyaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">10</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ अग्निगर्भच्छिदे नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Agnigarbhachchhide Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">11</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ इन्द्रश्रीप्रदाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Indrashripradaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">12</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ वाणीबलप्रदाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Vanibalapradaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">13</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ सर्वसिद्धिप्रदायकाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Sarvasiddhipradayakaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">14</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ शर्वतनयाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Sharvatanayaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">15</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ गौरीतनूजाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Gauritanujaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">16</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ शर्वरीप्रियाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Sharvaripriyaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">17</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ सर्वात्मकाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Sarvatmakaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">18</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ सृष्टिकर्त्रे नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Srishtikartre Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">19</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ देवानीकार्चिताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Devanikarchitaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">20</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ शिवाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Shivaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">21</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ शुद्धाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Shuddhaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">22</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ बुद्धिप्रियाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Buddhipriyaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">23</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ शान्ताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Shantaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">24</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ ब्रह्मचारिणे नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Brahmacharine Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">25</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ गजाननाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Gajananaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">26</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ द्वैमातुराय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Dwaimaturaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">27</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ मुनिस्तुत्याय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Munistutyaya Namah।</td>
</tr>
<tr height="80" style="border-spacing: 1px; height: 60.0pt;">
<td class="xl65" height="80" style="border-spacing: 1px; border-top: none; height: 60.0pt; width: 48pt;" width="64">28</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ भक्त विघ्न विनाशनाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Bhakta Vighna Vinashanaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">29</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ एकदन्ताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Ekadantaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">30</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ चतुर्बाहवे नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Chaturbahave Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">31</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ शक्तिसंयुताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Shaktisamyutaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">32</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ चतुराय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Chaturaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">33</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ लम्बोदराय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Lambodaraya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">34</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ शूर्पकर्णाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Shurpakarnaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">35</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ हेरम्बाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Herambaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">36</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ ब्रह्मवित्तमाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Brahmavittamaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">37</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ कालाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Kalaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">38</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ ग्रहपतये नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Grahapataye Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">39</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ कामिने नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Kamine Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">40</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ सोमसूर्याग्निलोचनाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Somasuryagnilochanaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">41</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ पाशाङ्कुशधराय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Pashankushadharaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">42</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ छन्दाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Chhandaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">43</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ गुणातीताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Gunatitaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">44</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ निरञ्जनाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Niranjanaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">45</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ अकल्मषाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Akalmashaya Namah।</td>
</tr>
<tr height="80" style="border-spacing: 1px; height: 60.0pt;">
<td class="xl65" height="80" style="border-spacing: 1px; border-top: none; height: 60.0pt; width: 48pt;" width="64">46</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ स्वयंसिद्धार्चितपदाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Swayamsiddharchitapadaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">47</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ बीजापूरकराय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Bijapurakaraya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">48</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ अव्यक्ताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Avyaktaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">49</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ गदिने नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Gadine Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">50</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ वरदाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Varadaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">51</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ शाश्वताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Shashwataya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">52</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ कृतिने नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Kritine Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">53</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ विद्वत्प्रियाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Vidwatpriyaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">54</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ वीतभयाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Vitabhayaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">55</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ चक्रिणे नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Chakrine Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">56</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ इक्षुचापधृते नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Ikshuchapadhrite Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">57</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ अब्जोत्पलकराय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Abjotpalakaraya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">58</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ श्रीधाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Shridhaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">59</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ श्रीहेतवे नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Shrihetave Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">60</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ स्तुतिहर्षताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Stutiharshataya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">61</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ कलाद्भृते नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Kaladbhrite Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">62</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ जटिने नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Jatine Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">63</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ चन्द्रचूडाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Chandrachudaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">64</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ अमरेश्वराय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Amareshwaraya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">65</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ नागयज्ञोपवीतिने नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Nagayajnopavitine Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">66</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ श्रीकान्ताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Shrikantaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">67</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ रामार्चितपदाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Ramarchitapadaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">68</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ वृतिने नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Vritine Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">69</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ स्थूलकान्ताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Sthulakantaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">70</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ त्रयीकर्त्रे नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Trayikartre Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">71</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ सङ्घोषप्रियाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Sanghoshapriyaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">72</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ पुरुषोत्तमाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Purushottamaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">73</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ स्थूलतुण्डाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Sthulatundaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">74</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ अग्रजन्याय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Agrajanyaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">75</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ ग्रामण्ये नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Gramanye Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">76</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ गणपाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Ganapaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">77</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ स्थिराय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Sthiraya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">78</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ वृद्धिदाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Vriddhidaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">79</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ सुभगाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Subhagaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">80</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ शूराय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Shuraya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">81</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ वागीशाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Vagishaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">82</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ सिद्धिदाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Siddhidaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">83</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ दूर्वाबिल्वप्रियाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Durvabilvapriyaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">84</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ कान्ताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Kantaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">85</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ पापहारिणे नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Papaharine Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">86</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ कृतागमाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Kritagamaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">87</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ समाहिताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Samahitaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">88</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ वक्रतुण्डाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Vakratundaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">89</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ श्रीप्रदाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Shripradaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">90</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ सौम्याय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Saumyaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">91</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ भक्ताकाङ्क्षितदाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Bhaktakankshitadaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">92</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ अच्युताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Achyutaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">93</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ केवलाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Kevalaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">94</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ सिद्धाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Siddhaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">95</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ सच्चिदानन्दविग्रहाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Sachchidanandavigrahaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">96</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ ज्ञानिने नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Jnanine Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">97</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ मायायुक्ताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Mayayuktaya Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">98</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ दन्ताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Dantaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">99</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ ब्रह्मिष्ठाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Brahmishthaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">100</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ भयावर्चिताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Bhayavarchitaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">101</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ प्रमत्तदैत्यभयदाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Pramattadaityabhayadaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">102</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ व्यक्तमूर्तये नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Vyaktamurtaye Namah।</td>
</tr>
<tr height="40" style="border-spacing: 1px; height: 30.0pt;">
<td class="xl65" height="40" style="border-spacing: 1px; border-top: none; height: 30.0pt; width: 48pt;" width="64">103</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ अमूर्तये नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Amurtaye Namah।</td>
</tr>
<tr height="100" style="border-spacing: 1px; height: 75.0pt;">
<td class="xl65" height="100" style="border-spacing: 1px; border-top: none; height: 75.0pt; width: 48pt;" width="64">104</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ पार्वतीशङ्करोत्सङ्गखेलनोत्सवलालनाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Parvatishankarotsangakhelanotsavalalanaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">105</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ समस्तजगदाधाराय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Samastajagadadharaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">106</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ वरमूषकवाहनाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Varamushakavahanaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">107</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ हृष्टस्तुताय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Hrishtastutaya Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">108</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ प्रसन्नात्मने नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Prasannatmane Namah।</td>
</tr>
<tr height="60" style="border-spacing: 1px; height: 45.0pt;">
<td class="xl65" height="60" style="border-spacing: 1px; border-top: none; height: 45.0pt; width: 48pt;" width="64">109</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 118pt;" width="157">ॐ सर्वसिद्धिप्रदायकाय नमः।</td>
<td class="xl65" style="border-left: none; border-spacing: 1px; border-top: none; width: 165pt;" width="220">Om Sarvasiddhipradayakaya Namah।</td>
</tr>
</tbody></table>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-57550543597144571582017-06-09T05:01:00.000-07:002017-06-09T05:01:28.061-07:00Saraswati Stotra<div dir="ltr" style="text-align: left;" trbidi="on">
<div style="text-align: left;">
Saraswati Stotram is one of the Stotrams of Saraswati Mata. This Stotram is recited on various occasions related to Goddess Saraswati.</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
॥श्रीसरस्वती स्तोत्रम्॥ </div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
या कुन्देन्दु-तुषारहार-धवला या शुभ्र-वस्त्रावृता </div>
<div style="text-align: center;">
या वीणावरदण्डमन्डितकरा या श्वेतपद्मासना।</div>
<div style="text-align: center;">
या ब्रह्माच्युत-शंकर-प्रभृतिभिर्देवैः सदा पूजिता </div>
<div style="text-align: center;">
सा मां पातु सरस्वती भगवती निःशेषजाड्यापहा ॥१॥</div>
<div style="text-align: center;">
<br />
दोर्भिर्युक्ता चतुर्भिः स्फटिकमणिमयीमक्षमालां दधाना </div>
<div style="text-align: center;">
हस्तेनैकेन पद्मं सितमपि च शुकं पुस्तकं चापरेण।</div>
<div style="text-align: center;">
भासा कुन्देन्दु-शंखस्फटिकमणिनिभा भासमानाऽसमाना </div>
<div style="text-align: center;">
सा मे वाग्देवतेयं निवसतु वदने सर्वदा सुप्रसन्ना ॥२॥</div>
<div style="text-align: center;">
<br />
आशासु राशी भवदंगवल्लि भासैव दासीकृत-दुग्धसिन्धुम्।</div>
<div style="text-align: center;">
मन्दस्मितैर्निन्दित-शारदेन्दुं वन्देऽरविन्दासन-सुन्दरि त्वाम् ॥३॥</div>
<div style="text-align: center;">
<br />
शारदा शारदाम्बोजवदना वदनाम्बुजे।</div>
<div style="text-align: center;">
सर्वदा सर्वदास्माकं सन्निधिं सन्निधिं क्रियात् ॥४॥</div>
<div style="text-align: center;">
<br />
सरस्वतीं च तां नौमि वागधिष्ठातृ-देवताम्।</div>
<div style="text-align: center;">
देवत्वं प्रतिपद्यन्ते यदनुग्रहतो जनाः ॥५॥</div>
<div style="text-align: center;">
<br />
पातु नो निकषग्रावा मतिहेम्नः सरस्वती।</div>
<div style="text-align: center;">
प्राज्ञेतरपरिच्छेदं वचसैव करोति या ॥६॥</div>
<div style="text-align: center;">
<br />
शुद्धां ब्रह्मविचारसारपरमा-माद्यां जगद्व्यापिनीं </div>
<div style="text-align: center;">
वीणापुस्तकधारिणीमभयदां जाड्यान्धकारापहाम्।</div>
<div style="text-align: center;">
हस्ते स्पाटिकमालिकां विदधतीं पद्मासने संस्थितां </div>
<div style="text-align: center;">
वन्दे तां परमेश्वरीं भगवतीं बुद्धिप्रदां शारदाम् ॥७॥</div>
<div style="text-align: center;">
<br />
वीणाधरे विपुलमंगलदानशीले </div>
<div style="text-align: center;">
भक्तार्तिनाशिनि विरिंचिहरीशवन्द्ये।</div>
<div style="text-align: center;">
कीर्तिप्रदेऽखिलमनोरथदे महार्हे </div>
<div style="text-align: center;">
विद्याप्रदायिनि सरस्वति नौमि नित्यम् ॥८॥</div>
<div style="text-align: center;">
<br />
श्वेताब्जपूर्ण-विमलासन-संस्थिते हे </div>
<div style="text-align: center;">
श्वेताम्बरावृतमनोहरमंजुगात्रे।</div>
<div style="text-align: center;">
उद्यन्मनोज्ञ-सितपंकजमंजुलास्ये </div>
<div style="text-align: center;">
विद्याप्रदायिनि सरस्वति नौमि नित्यम् ॥९॥</div>
<div style="text-align: center;">
<br />
मातस्त्वदीय-पदपंकज-भक्तियुक्ता </div>
<div style="text-align: center;">
ये त्वां भजन्ति निखिलानपरान्विहाय।</div>
<div style="text-align: center;">
ते निर्जरत्वमिह यान्ति कलेवरेण </div>
<div style="text-align: center;">
भूवह्नि-वायु-गगनाम्बु-विनिर्मितेन ॥१०॥</div>
<div style="text-align: center;">
<br />
मोहान्धकार-भरिते हृदये मदीये </div>
<div style="text-align: center;">
मातः सदैव कुरु वासमुदारभावे।</div>
<div style="text-align: center;">
स्वीयाखिलावयव-निर्मलसुप्रभाभिः </div>
<div style="text-align: center;">
शीघ्रं विनाशय मनोगतमन्धकारम् ॥११॥</div>
<div style="text-align: center;">
<br />
ब्रह्मा जगत् सृजति पालयतीन्दिरेशः </div>
<div style="text-align: center;">
शम्भुर्विनाशयति देवि तव प्रभावैः।</div>
<div style="text-align: center;">
न स्यात्कृपा यदि तव प्रकटप्रभावे </div>
<div style="text-align: center;">
न स्युः कथंचिदपि ते निजकार्यदक्षाः ॥१२॥</div>
<div style="text-align: center;">
<br />
लक्ष्मिर्मेधा धरा पुष्टिर्गौरी तृष्टिः प्रभा धृतिः।</div>
<div style="text-align: center;">
एताभिः पाहि तनुभिरष्टभिर्मां सरस्वती ॥१३॥</div>
<div style="text-align: center;">
<br />
सरसवत्यै नमो नित्यं भद्रकाल्यै नमो नमः।</div>
<div style="text-align: center;">
वेद-वेदान्त-वेदांग-विद्यास्थानेभ्य एव च ॥१४॥</div>
<div style="text-align: center;">
<br />
सरस्वति महाभागे विद्ये कमललोचने।</div>
<div style="text-align: center;">
विद्यारूपे विशालाक्षि विद्यां देहि नमोस्तु ते ॥१५॥</div>
<div style="text-align: center;">
<br />
यदक्षर-पदभ्रष्टं मात्राहीनं च यद्भवेत्।</div>
<div style="text-align: center;">
तत्सर्वं क्षम्यतां देवि प्रसीद परमेश्वरि ॥१६॥</div>
<div style="text-align: center;">
॥इति श्रीसरस्वती स्तोत्रम् संपूर्णं॥</div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-56028756931397326142017-06-09T04:40:00.002-07:002017-06-09T04:40:11.749-07:00Ganesha Stora with Twelve names<div dir="ltr" style="text-align: left;" trbidi="on">
<h2 style="text-align: center;">
Twelve names of Ganesha</h2>
<br />
<b>Pranamya Shirasa Devam</b><br />
<b>Gauriputram Vinaayakam l</b><br />
<b>Bhakataavaasam Smare Nityam</b><br />
<b>Aayuh Kaamartha Siddhaye ll 1 ll</b><br />
<br />
Meaning: Every day, I bow down to that Lord, the son of Gowri, the Lord one who lives in the heart of the devotees, blessing them always with good health and prosperity.<br />
<br />
<b>Prathamam Vakratundam Cha</b><br />
<b>Ekadantam Dviteeyakam l</b><br />
<b>Thriteeyam Krishna Pingaaksham</b><br />
<b>Gajavaktram Chaturthakam ll 2 ll</b><br />
<br />
Meaning: Starting from here the twelve names of Ganesha are mentioned and he is worshipped in those different forms. The first as the Lord with the curved trunk; second, as the one with only one tusk, third, as the one with black (red/brown) eyes, fourth, as the one with giant structure.<br />
<br />
<b>Lambodaram Panchamaam Cha</b><br />
<b>Shashtam Vikatameva Cha l</b><br />
<b>Saptamam Vighnaraajendram</b><br />
<b>Dhoomravarnam Tathaashtamam ll 3 ll</b><br />
<br />
Meaning: Fifth, as the one with a big (long) stomach, six, as the one with a huge body Seven, as the remover of obstacles, eight, as the one with smoke gray color.<br />
<b><br /></b>
<b>Navamam Phaalachandram Cha</b><br />
<b>Dasamam Tu Vinaayakam l</b><br />
<b>Ekaadasam Ganapatim</b><br />
<b>Dvaadasam Tu Gajaananam ll 4 ll</b><br />
<br />
Meaning: Ninth, as the one with moon on the front of His head, tenth, as the foremost leader, eleventh, as the leader of the ganas, twelfth as the one with elephant face.<br />
<br />
<b>Dvaadasaitaani Naamaani</b><br />
<b>Trisandhyam Yah Pathernnarah l</b><br />
<b>Na Cha Vighna Bhayam Tasya</b><br />
<b>Sarva Siddhikaram Prabho ll 5 ll</b><br />
<br />
Meaning: Any person, who remembers these twelve names of Ganesha, three times in a day, will have all their obstacles and fear removed and will attain success. (This group of verses is said to be sage Narada’s offering to Lord Ganesh.)</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-1979425825109212752017-05-05T05:04:00.000-07:002017-05-05T05:04:10.557-07:00Ganapati Atharvashirsha with meaning<div dir="ltr" style="text-align: left;" trbidi="on">
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://www.blogger.com/" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"></a><br /></div>
<h3 style="border-image: none; text-align: center;">
Ganapati Atharvashirsha with Meaning</h3>
<div align="center" style="border-image: none;">
<table border="0" cellpadding="0" style="mso-cellspacing: 1.5pt; mso-padding-alt: 7.5pt 7.5pt 7.5pt 7.5pt; mso-yfti-tbllook: 1184;">
<tbody>
<tr style="mso-yfti-firstrow: yes; mso-yfti-irow: 0;">
<td style="background-color: transparent; border-image: none; border: rgb(0, 0, 0); padding: 7.5pt;" valign="top"><div style="line-height: 13.5pt; margin: 0in 0in 12pt;">
<div style="border-image: none;">
<b><span style="font-family: "verdana" , "sans-serif"; font-size: 9pt;">Om Namste Ganpataye<br />Tvameva Pratyaksham Tatvamasi<br />Tvamev Kevalam Kartasi<br />Tvamev Kevalam Dhartasi<br />Tvamev Kevlam Hartasi<br />Tvamev Sarvam Khalvidam Bramhasi<br />Tvam Sakshadatmasi Nityam || 1 ||<br />
</span></b><span style="font-family: "verdana" , "sans-serif"; font-size: 9pt;"><br />O Lord Ganesha <br />I Pay my deep homage to you, the Lord of the Deva-Gana <br />You are the first facet of the Bramha-Tatva to arise <br />You have alone created this Entire universe<br />You alone can maintain this universe <br />You are indeed the all conquering supreme Lord <br />Indeed you are the "ATMA" || 1 ||</span></div>
</div>
</td>
<td style="background-color: transparent; border-image: none; border: rgb(0, 0, 0); padding: 7.5pt;"><div align="center" style="line-height: 13.5pt; margin: 0in 0in 0pt; text-align: center;">
<div style="border-image: none;">
<span style="font-family: "verdana" , "sans-serif"; font-size: 9pt;"></span><br /></div>
</div>
</td>
</tr>
<tr style="mso-yfti-irow: 1; mso-yfti-lastrow: yes;">
<td colspan="2" style="background-color: transparent; border-image: none; border: rgb(0, 0, 0); padding: 7.5pt;"><div style="line-height: 13.5pt; margin: 0in 0in 0pt;">
<div style="border-image: none;">
<b><span style="font-family: "verdana" , "sans-serif"; font-size: 9pt;">Rritam Vachmi<br />Satyam Vachmi || 2 ||<br />
</span></b><span style="font-family: "verdana" , "sans-serif"; font-size: 9pt;"><br />Speak noble fact<br />Speak complete Truth || 2 ||<br />
<br />
<b>Ava tvam Mam<br />Ava Vaktaram<br />Ava Shrotaram<br />Ava Dataram<br />Ava Dhataram<br />Avanuchanamv Shishyam<br />Ava Paschatat<br />Ava Purastat<br />Avo Uttaratat<br />Ava Dakshinatat<br />Ava chordhvatat<br />Ava Dharatat<br />Sarvatomam Pahi Pahi Samantat || 3 ||<br />
</b><br />Protect me <br />Protect the one who Describes you <br />Protect all who hear about your characteristics<br />Protect me & the disciples who are under Tutelage <br />Protect me from the obstacles (which arise during Rituals)<br />From the east (Similarly)<br />Protect me from the West,<br />From the North<br />From the South<br />Protect me from above & below<br />Protect me from all directions || 3 ||<br />
<br />
<b>Tvam Vangmayastvam Chinmaya<br />Tvam Anandmayastvam Bramhamaya<br />Tvam Sachitananda Dvitiyosi<br />Tvam Pratyaksham Bramhasi<br />Tvam Jnanmayo Vijnanamayo Asi || 4 ||<br />
</b><br />You are the constituent of speech<br />You are Joy & Immortal Consciousness<br />You are Truth, Mind & Bliss... one without a second<br />You are none other than divinity<br />You are Knowledge of Gross & Subtle types || 4 || <br />
<br />
<b>Sarvam Jagadidam Tatvo Jayate<br />Sarvam Jagadidam Tvat Sti Shastati<br />Sarvam Jagadidam Tvay Layamesyati<br />Sarvam Jagadidam Tvayi Pratyeti<br />Tvam Bhumi Rapo Nalo Nilo Nabha<br />Tvam Chatvarim Vak Padaini || 5 ||<br />
</b><br />All the Universes manifest due to you <br />All the Universes are sustained by you <br />All the Universes get destroyed in you <br />All the Universes finally get merged in you<br />You alone are Earth. Water, Fire, Air & Either <br />You are the 4 types of speech & the root source of sound || 5 ||<br />
<br />
<b>Tvam Guna Traya Atitaha<br />Tvam Deha Treya Atitaha<br />Tvam Kala Treya Atitaha<br />Tvam Avastreya Atitaha<br />Tvam Muladhar Stiti Yosi Nityam <br />Tvam Shakti Treya Atmakaha<br />Tvam Yogino Dhayayanti Nityam <br />Tvam Bramhastvan, Vishnustvam, Rudrastvam, Indrastvam Agnistvam, Vayustvam, Suryastvam, Chndramastvam, Bramha Bhur Bhuva Svorom || 6 || <br />
</b><br />You are beyond the 3 'GUNAS', (Satva; Pure, Rajas: Activating & Tamas: Dull) <br />You are beyond the 3 Bodies; (Gross, Subtle & Casual) <br />You are beyond Past, Present & Future (3 State of Time) <br />You are beyond 3 states of being; (Awake, dream & Deep Sleep) <br />You always Reside in the "MULADHARA" Chakra <br />You are the trinity of Power; (Creative Maintaining & Destructive Powers) <br />Sages always Meditate on you <br />You are the creator. Sustainer, Destroyer, The Lord of 3 worlds, Fire, Air, Sun, Moon, You are all inclusive & all Pervading || 6 || <br />
<br />
<b>Ganadim Purvamuccharaya Varnadim Tada Nantaram<br />Anusvara Paratarah<br />Ardhendu Lasitam<br />Taren Hridam<br />Etatva Manu Svarupam<br />Gakarah Purva Rupam<br />Akaro Madhyam Rupam<br />Anu Svaraschantya Rupam<br />Bindu Ruta Rupam <br />Nadah Sandhanam <br />Sagm Hitaa Sandihi <br />Sesha Ganeshvidhya <br />Ganal Rishi; Nichrud Gayatri chandah <br />Ganpatir devata <br />Om 'GUNG' Ganpataye Namah || 7 ||<br />
</b><br />After Describing the Characteristics & Cosmic Attributes Of Lord Ganesha, Atharvan Rishi Gives us the Sacred "GANESH VIDYA" i.e. the Mantra which Reveals the Sacred Form of Lord Ganesh. The Letter "GA" is to be enunciated, following by "NA" This one word Mantra is then Potentiated with the "PRANAVA" "OM". This is Sacred Mantra. (In order to make it Simpler, Atharvan Rishi Present the above easier FASHION, Remember that Knowledge was transmitted orally in those days.) <br />"GA" is the first part, "Na" is the middle & end "UM" formed by the bindu is conjoined with the foregoing & all of them form the Sacred word. This Mantra if pronounced properly, has the power of revaling The Divine Lord Ganesh, The sage who receives the Mantra is Ganaka & the Metre is "NICHRAT GAYATRI" The Diety is Ganapati. Om 'GANG' Ganapati My salutation to you || 7 ||<br />Saying Thus, The Devotees should bow to the Lord.<br />
<br />
<b>Ek Dantaya Vid Mahe vakra Tundaya Dhimahi <br />Tanno danti Prachodayat || 8 ||<br />
</b><br />Mediate on the single Tusked Lord, with bent Trunk <br />May He Grant Knowledge & Inspire me || 8 ||<br />
<br />
<b>Ek Dantam Chatur Hastam Pashmam Kusha Dharinam<br />Radamch Vardam Hastair Bhi Bhranum Mushaka Dhvajam <br />Raktam Lambodaram Shoorpakarnkam Rakta Vasasamam<br />Raktam Gandhanu Liptangam Rakta Pushpaihi saupujitam<br />Bhaktanu Kampinam Devam Jagat Karnam Achutam <br />Avir Bhutam Cha Shrasta Yadao, Prakruthe Purushat Param <br />Evam Dhayayati Yo Nityam, Sa Yogi Yoginam Varah || 9 ||<br />
</b><br />The "SAGUNA" Form of Lord Ganesha is presented in the above Shloka I salute the Lord with 1 tusk (Right side) Who has 4 hands; <br />Upper Right carrying binding rope; Upper left hoalding goad; lower left carrying Broken tusk & the lower right blesses us, the mouse on his banner is also his vehicle.<br />He is blood red in colour; Pot-Bellied; He has elephant ears & wears red clothes <br />He is smeared with red sandalwood & decorated with red flowers<br />He is eternally blessings his devotees & was existing before Cosmos<br />He is beyond "PRAKRITI" & "PURUSHA" & is ever creating universes <br />One who meditates on him constantly, is a Supreme Yogi || 9 ||<br />(This is the Ganesh "Gayatri", Which is Self Sufficient)<br />
<br />
<b>Namo Vrat Pataye, Namo Ganapataye <br />Namo Pramatha patye, Namste Stu Lambodaraya Ekdantaya, Vighna Nashine Shiv Sutaya, Sri Varad Murtiye Namo Namah || 10 ||<br />
</b><br />Salutations to you Lord of all Deities, Ganas & all beings <br />(Salutations To) The Post-Bellied one with 1 Tusk who destroys all obstacles, son if Shiva The Divine Lord who grants, Boons (We bow to you) Taking your name || 10 ||</span></div>
</div>
</td>
</tr>
</tbody></table>
</div>
<br />
<div style="margin: 0in 0in 8pt;">
</div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-45212868103483296382016-08-01T00:48:00.003-07:002016-08-01T00:48:42.731-07:00Shri Vishnu Aarti<div dir="ltr" style="text-align: left;" trbidi="on">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg3KpllHQyiADyIYgmcVHnxSAibX0DI3m7IXPre0KuqWueqMv8af6s5Qa2q9rx_-d95mfvKoqyFLpVwP6JS18NS7gqclXJOLxR6551eEpx3CWDTpwwq93DXehD_gF3mx-YD8jJ-HGrEzEA/s1600/vishnu1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg3KpllHQyiADyIYgmcVHnxSAibX0DI3m7IXPre0KuqWueqMv8af6s5Qa2q9rx_-d95mfvKoqyFLpVwP6JS18NS7gqclXJOLxR6551eEpx3CWDTpwwq93DXehD_gF3mx-YD8jJ-HGrEzEA/s1600/vishnu1.jpg" /></a></div>
<br /><br />
<h3 style="text-align: center;">
<span lang="en-us">Shri Vishnu Aarti Lyrics</span></h3>
<br /><br />
<div style="text-align: center;">
<pre style="font-family: Arial; margin: 0in 0in 0pt;"><span lang="en-us"><span style="font-size: small;">S</span></span><span style="font-size: small;">antasanakadika bhakta mi<span lang="en-us">l</span>ale aneka </span><span lang="en-us"><span style="font-size: small;">I</span></span></pre>
</div>
<div style="text-align: center;">
<pre style="font-family: Arial; margin: 0in 0in 0pt;"><span style="font-size: small;"><span lang="en-us">S</span>va<span lang="en-us">na</span>nden garjati pahun aale kautuk<span lang="en-us">u</span> <span lang="en-us">II </span>1</span><span lang="en-us"><span style="font-size: small;"> II</span></span></pre>
</div>
<div style="text-align: center;">
<pre style="font-family: Arial; margin: 0in 0in 0pt;"><span lang="en-us"><span style="font-size: small;">N</span></span><span style="font-size: small;">aval hotahe aarti devadhideva <span lang="en-us">I</span></span></pre>
</div>
<div style="text-align: center;">
<pre style="font-family: Arial; margin: 0in 0in 0pt;"><span style="font-size: small;"><span lang="en-us">S</span>varginhuni suravara pahun yeti keshava <span lang="en-us">II</span> <span lang="en-us">Dhr.</span> </span><span lang="en-us"><span style="font-size: small;">II</span></span></pre>
</div>
<div style="text-align: center;">
<pre style="font-family: Arial; margin: 0in 0in 0pt;"><span style="font-size: small;"> </span></pre>
</div>
<div style="text-align: center;">
<pre style="font-family: Arial; margin: 0in 0in 0pt;"><span style="font-size: small;"><span lang="en-us">N</span>ara nari ta<span lang="en-us">t</span>astha <span lang="en-us">t</span>aka pa<span lang="en-us">d</span>ilen nayana <span lang="en-us">I</span></span></pre>
</div>
<div style="text-align: center;">
<pre style="font-family: Arial; margin: 0in 0in 0pt;"><span style="font-size: small;"><span lang="en-us">O</span>vaLitan shrimukha dha<span lang="en-us">n</span>i na pure mana <span lang="en-us">II </span>navala<span lang="en-us"> II</span> 2<span lang="en-us"> </span></span><span lang="en-us"><span style="font-size: small;">II</span></span></pre>
</div>
<div style="text-align: center;">
<pre style="font-family: Arial; margin: 0in 0in 0pt;"><span style="font-size: small;"> </span></pre>
</div>
<div style="text-align: center;">
<pre style="font-family: Arial; margin: 0in 0in 0pt;"><span style="font-size: small;"><span lang="en-us">E</span>kaa janaardanin mangala <span lang="en-us">A</span>artya gaati <span lang="en-us">I</span></span></pre>
</div>
<div style="text-align: center;">
<pre style="font-family: Arial; margin: 0in 0in 0pt;"><span lang="en-us"><span style="font-size: small;">M</span></span><span style="font-size: small;">angala kautuken gati <span lang="en-us">I</span></span></pre>
</div>
<div style="text-align: center;">
<pre style="font-family: Arial; margin: 0in 0in 0pt;"><span style="font-size: small;">mi<span lang="en-us">l</span>ale vaish<span lang="en-us">n</span>ava jayajayakaren garjati <span lang="en-us">II</span> navala <span lang="en-us">II </span>3<span lang="en-us"> </span></span><span lang="en-us"><span style="font-size: small;">II</span></span></pre>
</div>
<div style="text-align: center;">
<pre style="font-family: Arial; margin: 0in 0in 0pt;"><b><span lang="en-us">
</span></b></pre>
</div>
<h3 style="font-family: Arial; margin: 0in 0in 0pt; text-align: center;">
<span lang="en-us">Shri Vishnu Aarti in Marathi</span></h3>
<h3 style="font-family: Arial; margin: 0in 0in 0pt; text-align: center;">
<span lang="en-us"><br /></span></h3>
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgm2PnPgHFcBPgj87M0L10PWjNL4fhc20c_MnG2xQOxsxZoUt4utoDWVljwrFUvea2TE1lmtlTWcb1tCe0jY3xpXvqozsHiM2Ppd-eHwBqtLTokXrLpPY6S5Ouf7s-KH5RaT973lKAuc8c/s1600/vishnu_aarti.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgm2PnPgHFcBPgj87M0L10PWjNL4fhc20c_MnG2xQOxsxZoUt4utoDWVljwrFUvea2TE1lmtlTWcb1tCe0jY3xpXvqozsHiM2Ppd-eHwBqtLTokXrLpPY6S5Ouf7s-KH5RaT973lKAuc8c/s1600/vishnu_aarti.jpg" /></a></div>
<h3 style="font-family: Arial; margin: 0in 0in 0pt; text-align: center;">
<span lang="en-us"><br /></span></h3>
<div style="text-align: center;">
<pre style="font-family: Arial; margin: 0in 0in 0pt;"><b><span lang="en-us">
</span></b></pre>
</div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-20426215710158480472016-07-08T23:45:00.001-07:002016-07-08T23:45:27.280-07:00Meaning of Ghalin Lotangan<div dir="ltr" style="text-align: left;" trbidi="on">
<div class="separator" style="clear: both; text-align: center;">
</div>
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiVC30bf4ViPMSul1krCRbhKXVQIDX7yc4PfCev3biUo4VAC7Oll02cVGb9EoCZJD3gU9AIc8_s6PcpHu2NL1AJTMVsJGLOXuiXbOViPNWhAcnnOJrx0dWKaK-io0CPdPgCzeCdXq9dYB4/s1600/ghalin+lotangan1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="225" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiVC30bf4ViPMSul1krCRbhKXVQIDX7yc4PfCev3biUo4VAC7Oll02cVGb9EoCZJD3gU9AIc8_s6PcpHu2NL1AJTMVsJGLOXuiXbOViPNWhAcnnOJrx0dWKaK-io0CPdPgCzeCdXq9dYB4/s400/ghalin+lotangan1.jpg" width="400" /></a></div>
<div style="text-align: justify;">
<b><br /></b></div>
<div style="text-align: justify;">
<b>Ghalin Lotangan Vandin Charan, </b><span style="font-weight: bold;">Dolyani Pahin Rupa tujhe|</span></div>
<div style="text-align: justify;">
<b>Preme Alingin Anande Pujin, </b><b>Bhave Ovaalin Mhanen Naamah||1||</b></div>
<div style="text-align: justify;">
I bow low to you, I worship your holy feet.I fill my eyes with your sight.</div>
<div style="text-align: justify;">
Will hug you with all my love and worship you with all the happiness within!I worship (you) with all my heart (devotion, feelings)</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>Twamev Mata Pita Twamev, </b><b>Twamev Bandhusch Sakha Twamev|</b></div>
<div style="text-align: justify;">
<b>Twamev Vidya Dravinam Twamev| , </b><b>Twamev Sarvam Mam Dev Dev||2||</b></div>
<div style="text-align: justify;">
After all, you only are my Mother, You are my Father.You are my Sibling and my companion.</div>
<div style="text-align: justify;">
You, and none else, are my knowledge and money.You are my everything</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>Kaayen Vacha Mansendriyevaah,Buddhyatmnava prakrute swabhavat |</b></div>
<div style="text-align: justify;">
<b>Karomi Yad Yat Sakalam Parasmai,Narayana Iti Samarpayami ||3 ||</b></div>
<div style="text-align: justify;">
I dedicate to Lord Narayana(Vishnu) whatever actions(endeavors, Yajna) I perform: with my body, speech, mind, limbs, intellect or mind; performed either intentionally or unintentionally (naturally, involuntarily).</div>
<div style="text-align: justify;">
<b><br /></b></div>
<div style="text-align: justify;">
<b>Achyutam Keshvam Ram Narayanam,Krushna Damodaram Vasudevam Hari |</b></div>
<div style="text-align: justify;">
<b>Sridharam Madhavam Gopika Vallabham ,Janaki Nayakam Ramchandra Bhaje ||4||</b></div>
<div style="text-align: justify;">
Salute You O Acyuta (the Infallible One), I Salute You O Keshava (Who nominates and Controls everyone, Who has beautiful Hair and Who killed the demon Keshi), I Salute You O Rama the Incarnation of Narayana (Who is without any blemish),</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>Hare Ram Hare Ram</b></div>
<div style="text-align: justify;">
<b>Ram Ram Hare Hare</b></div>
<div style="text-align: justify;">
<b>Hare Krushna Hare Krushna Krushna Krushna Hare Hare!!</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
All Hail to Lord Krishna Narayana!!May HE continue to bless us with all the love!!<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<iframe width="320" height="266" class="YOUTUBE-iframe-video" data-thumbnail-src="https://i.ytimg.com/vi/iLLcyy82Is4/0.jpg" src="https://www.youtube.com/embed/iLLcyy82Is4?feature=player_embedded" frameborder="0" allowfullscreen></iframe></div>
<br /></div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-51025959368923696912016-06-08T02:43:00.000-07:002016-06-08T02:43:11.662-07:00Shri Dashavtar Aarti<div dir="ltr" style="text-align: left;" trbidi="on">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhBfMJ1_APpv-cTost1ATlK29seAi_PO5BGz8GNz5Vg6ZUyR2txJQqs33oqx_2lVCGxMPX8qtE6UNGkPhbC_Cca43ojDY_K1seYotX0DLQl1cPviVOKV0pGFcXoWcllEcKnA6pp790C1jo/s1600/Dashavtar1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="320" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhBfMJ1_APpv-cTost1ATlK29seAi_PO5BGz8GNz5Vg6ZUyR2txJQqs33oqx_2lVCGxMPX8qtE6UNGkPhbC_Cca43ojDY_K1seYotX0DLQl1cPviVOKV0pGFcXoWcllEcKnA6pp790C1jo/s320/Dashavtar1.jpg" width="318" /></a></div>
<h2 style="text-align: center;">
<b>दशावतारांची आरती – आरती सप्रेम</b></h2>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
आरती सप्रेम जय जय विठ्ठल परब्रह्म ।</div>
<div style="text-align: center;">
भक्त संकटिं नानास्वरूपीं स्थापिसि स्वधर्म ॥ ध्रु० ॥</div>
<div style="text-align: center;">
अंबऋषीकारणें गर्भवास सोशीसी ।</div>
<div style="text-align: center;">
वेद नेले चोरूनि ब्रह्मया आणुनियां देसी ॥</div>
<div style="text-align: center;">
मत्स्यरूपी नारायण सप्तहि सागर धुंडीसी ।</div>
<div style="text-align: center;">
हस्त लागतां शंखासुरा तुझा वर देसी ॥ आरती० ॥ १ ॥</div>
<div style="text-align: center;">
रसातळासी जातां पृथ्वी पाठीवर घेसी ।</div>
<div style="text-align: center;">
परोपकरासाठीं देवा कांसव झालासी ॥</div>
<div style="text-align: center;">
दाढें धरुनी पृथ्वी नेतां वराहरूप होसी ।</div>
<div style="text-align: center;">
प्रल्हादाकारणें स्तंभीं नरहरि गुरगुरसी ॥ आरती० ॥ २ ॥</div>
<div style="text-align: center;">
पांचवे अवतारीं बळिच्या द्वाराला जासी ।</div>
<div style="text-align: center;">
भिक्षे स्थळ मागुनीं बळीला पाताळा नेसी ॥</div>
<div style="text-align: center;">
सर्व समर्पण केलं म्हणुनी प्रसन्न त्या होसी ।</div>
<div style="text-align: center;">
वामनरूप धरुनी बळिच्या द्वारीं तिष्ठसी ॥ आरती० ॥ ३ ॥</div>
<div style="text-align: center;">
सहस्त्रार्जुन मातला जमदग्नीचा वध केला ।</div>
<div style="text-align: center;">
कष्टी ते रेणुका म्हणुनी सहस्त्रार्जुन वधिला ॥</div>
<div style="text-align: center;">
निःक्षत्री पृथ्वी दान दिधली विप्राला ।</div>
<div style="text-align: center;">
सहावा अवतार परशुराम प्रगटला ॥ आरती० ॥ ४ ॥</div>
<div style="text-align: center;">
मातला रावण सर्वां उपद्रव केला ।</div>
<div style="text-align: center;">
तेहतिस कोटी देव बंदी हरिलें सीतेला ॥</div>
<div style="text-align: center;">
पितृवचनालागीं रामें वनवास केला ।</div>
<div style="text-align: center;">
मिळोनि वानरसहित राजा राम प्रगटला ॥ आरती० ॥ ५ ॥</div>
<div style="text-align: center;">
देवकीवसुदेवबंदीमोचन त्वां केलें ।</div>
<div style="text-align: center;">
नंदाघरीं जाउनी निजसुख गोकुळा दिधलें ।</div>
<div style="text-align: center;">
गोरसचोरी करितां नवलक्ष गोपाळ मिळविले ।</div>
<div style="text-align: center;">
गोपिकांचें प्रेम देखुनि श्रीकृष्ण भुलले ॥ आरती० ॥ ६ ॥</div>
<div style="text-align: center;">
बौद्ध कलंकी कलियुगीं झाला अधर्म हा अवघा ।</div>
<div style="text-align: center;">
सोडुनी दिधला धर्म म्हणुनी न दिससी देवा ॥</div>
<div style="text-align: center;">
म्लेंच्छमर्दन करिसी ह्मणोनि कलंकी केशवा ।</div>
<div style="text-align: center;">
बहिरवि जान्हवी द्यावी निजसुखानंदाची सेवा ॥ आरती० ॥ ७ ॥</div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-51092709602605139972016-06-08T02:42:00.003-07:002016-06-08T02:42:42.909-07:00Shri Krishna Aarti<div dir="ltr" style="text-align: left;" trbidi="on">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjeBRY2N7w4Pam7N_di4GO-QdjHpjwT5RQIksCyqkkrcYhHU5kTzLOlEHSkkuGFdygij33TU_WfNPS3dCZsG86Qaefyf2FtGrtTVCRRn2TI9vwrjMTFja5zo0juUQaLXk-jx5CEgSfbB6g/s1600/krishna1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="300" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjeBRY2N7w4Pam7N_di4GO-QdjHpjwT5RQIksCyqkkrcYhHU5kTzLOlEHSkkuGFdygij33TU_WfNPS3dCZsG86Qaefyf2FtGrtTVCRRn2TI9vwrjMTFja5zo0juUQaLXk-jx5CEgSfbB6g/s400/krishna1.jpg" width="400" /></a></div>
<div style="text-align: left;">
<br /></div>
<div style="text-align: left;">
Ovalu Aarti Madangopala is one of the most popular Marathi Aarti of Shri Krishna.This Marathi Aarti of Shri Krishna is recited on most occasions related to Lord Krishna especially on Janmashtami day.</div>
<div style="text-align: center;">
श्री कृष्णाची आरती </div>
<div style="text-align: center;">
ओवालू आरती मदनगोपाळा।</div>
<div style="text-align: center;">
श्यामसुन्दर गळा लं वैजयन्तीमाळा॥</div>
<div style="text-align: center;">
चरणकमल ज्याचे अति सुकुमार।</div>
<div style="text-align: center;">
ध्वजवज्रानकुश ब्रीदाचा तोडर॥</div>
<div style="text-align: center;">
ओवालू आरती मदनगोपाळा...॥</div>
<div style="text-align: center;">
नाभीकमळ ज्याचेब्रह्मयाचे स्थान।</div>
<div style="text-align: center;">
ह्रीदयीन पदक शोभे श्रीवत्सलांछन॥</div>
<div style="text-align: center;">
ओवालू आरती मदनगोपाळा...॥</div>
<div style="text-align: center;">
मुखकमळा पाहता सूर्याचिया कोटी।</div>
<div style="text-align: center;">
वेधीयेले मानस हारपली धृष्टी॥</div>
<div style="text-align: center;">
ओवालू आरती मदनगोपाळा...॥</div>
<div style="text-align: center;">
जडित मुगुट ज्याच्या देदीप्यमान।</div>
<div style="text-align: center;">
तेणे तेजे कोदले अवघे त्रिभुवन॥</div>
<div style="text-align: center;">
ओवालू आरती मदनगोपाळा...॥</div>
<div style="text-align: center;">
एका जनार्दनी देखियले रूप।</div>
<div style="text-align: center;">
रूप पाहों जाता झालेसें तद्रूप॥</div>
<div style="text-align: center;">
ओवालू आरती मदनगोपाळा...॥</div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-16129141398384894312016-06-08T02:42:00.001-07:002016-06-08T02:42:08.136-07:00Shri Mahalakshmi Devi Aarti<div dir="ltr" style="text-align: left;" trbidi="on">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEi0XmfqPExfmYNMWN-9gjZrFZrJBFCQt_CNjHlcdTojJnGDpwBBPvwml-sivgCz75iq2-5wiw3-LT1MNfghl74XdgDCH5fyzG7jAReMuJCNMXBYGl7MqFtldav6d4l5KjxsTHyiy5kfWYY/s1600/Mahalakshmi1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="320" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEi0XmfqPExfmYNMWN-9gjZrFZrJBFCQt_CNjHlcdTojJnGDpwBBPvwml-sivgCz75iq2-5wiw3-LT1MNfghl74XdgDCH5fyzG7jAReMuJCNMXBYGl7MqFtldav6d4l5KjxsTHyiy5kfWYY/s400/Mahalakshmi1.jpg" width="400" /></a></div>
<div style="text-align: left;">
<br /></div>
<div style="text-align: left;">
Jai Devi Jai Devi Jai Mahalakshmi is one of the most famous Marathi Aarti of Shri Mahalakshmi. This famous Aarti of Mahalakshmi Mata is recited on most occasions related to Goddess Lakshmi.</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
श्री महालक्ष्मीची आरती </div>
<div style="text-align: center;">
जय देवी जय देवी जय महालक्ष्मी।</div>
<div style="text-align: center;">
वससी व्यापकरुपे तू स्थूलसूक्ष्मी॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
करवीरपुरवासिनी सुरवरमुनिमाता।</div>
<div style="text-align: center;">
पुरहरवरदायिनी मुरहरप्रियकान्ता।</div>
<div style="text-align: center;">
कमलाकारें जठरी जन्मविला धाता।</div>
<div style="text-align: center;">
सहस्त्रवदनी भूधर न पुरे गुण गातां॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
जय देवी जय देवी...॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
मातुलिंग गदा खेटक रविकिरणीं।</div>
<div style="text-align: center;">
झळके हाटकवाटी पीयुषरसपाणी।</div>
<div style="text-align: center;">
माणिकरसना सुरंगवसना मृगनयनी।</div>
<div style="text-align: center;">
शशिकरवदना राजस मदनाची जननी॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
जय देवी जय देवी...॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
तारा शक्ति अगम्या शिवभजकां गौरी।</div>
<div style="text-align: center;">
सांख्य म्हणती प्रकृती निर्गुण निर्धारी।</div>
<div style="text-align: center;">
गायत्री निजबीजा निगमागम सारी।</div>
<div style="text-align: center;">
प्रगटे पद्मावती निजधर्माचारी॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
जय देवी जय देवी...॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
अमृतभरिते सरिते अघदुरितें वारीं।</div>
<div style="text-align: center;">
मारी दुर्घट असुरां भवदुस्तर तारीं।</div>
<div style="text-align: center;">
वारी मायापटल प्रणमत परिवारी।</div>
<div style="text-align: center;">
हें रुप चिद्रूप दावी निर्धारी॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
जय देवी जय देवी...॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
चतुराननें कुश्चित कर्मांच्या ओळी।</div>
<div style="text-align: center;">
लिहिल्या असतिल माते माझे निजभाळी।</div>
<div style="text-align: center;">
पुसोनि चरणातळी पदसुमने क्षाळी।</div>
<div style="text-align: center;">
मुक्तेश्वर नागर क्षीरसागरबाळी॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
जय देवी जय देवी...॥</div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-90092179864242115732016-06-08T02:41:00.001-07:002016-06-08T02:41:38.109-07:00Shri Maruti Aarti<div dir="ltr" style="text-align: left;" trbidi="on">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEivVat0kqWF3271S6tTh8PIh815sxViISQ_b_TXiEltOO9ZsW63R78Kps8gJsUESIdpkCRByaxOaehrafPrDwhOtlD7nrpKIV-6ZAN9qBwwhDyOBdWD7aB25xQqW0vju9833akwQgDkdp8/s1600/Hanuman4.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="225" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEivVat0kqWF3271S6tTh8PIh815sxViISQ_b_TXiEltOO9ZsW63R78Kps8gJsUESIdpkCRByaxOaehrafPrDwhOtlD7nrpKIV-6ZAN9qBwwhDyOBdWD7aB25xQqW0vju9833akwQgDkdp8/s400/Hanuman4.jpg" width="400" /></a></div>
<br />
Satrane Uddane Hunkar Vadani is very popular Marathi Aarti of Hanuman. Hanuman Aarti is recited on Hanuman Jayanti .<a href="http://marutistotra.blogspot.in/2012/08/maruti-stotra.html" target="_blank">Hanuman Strotra</a> and <a href="http://marutistotra.blogspot.in/2015/01/hanuman-chalisa.html" target="_blank">Hanuman Chalisa</a> is also recited to pray for Shri Hanuman.<br />
<br />
<h2 style="text-align: center;">
श्रीमारुतीची आरती </h2>
<div style="text-align: center;">
सत्राणें उड्डाणें हुंकार वदनीं ।</div>
<div style="text-align: center;">
करि डळमळ भूमंडळ सिंधूजळ गगनीं ॥</div>
<div style="text-align: center;">
गडबडिलें ब्रह्मांड धाकें त्रिभुवनीं ।</div>
<div style="text-align: center;">
सुरवर नर निशाचर त्यां झाल्या पळणी ॥ १ ॥</div>
<div style="text-align: center;">
जय देव जय देव जय हनुमंता ।</div>
<div style="text-align: center;">
तुमचे नि प्रसादें न भीं कृतांता ॥ ध्रु० ॥</div>
<div style="text-align: center;">
दुमदुमिलीं पाताळें उठिला प्रतिशब्द ।</div>
<div style="text-align: center;">
थरथरला धरणीधर मानीला खेद ॥</div>
<div style="text-align: center;">
कडकडिले पर्वत उड्डगण उच्छेद ॥</div>
<div style="text-align: center;">
रामीं रामदासा शक्तीचा बोध ॥ जय देव० ॥ २ ॥</div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-84578907800304075522016-06-08T02:41:00.000-07:002016-06-08T02:41:09.821-07:00Shri Dattatreya Aarti<div dir="ltr" style="text-align: left;" trbidi="on">
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhDdVwx2wGlb0Rvuzl-k4BitaDUkxlfI8FQjLNLf_IlAEb4005JNj1YEFMdStPuJi4zYLIoonh0nqUTUAFaybzP5A9PUNTJ_fAdq6wA-PtYGnZo9vFVgQnJOGt2pWQ1mTa8XFNhOQk382Q/s1600/Datta1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="300" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhDdVwx2wGlb0Rvuzl-k4BitaDUkxlfI8FQjLNLf_IlAEb4005JNj1YEFMdStPuJi4zYLIoonh0nqUTUAFaybzP5A9PUNTJ_fAdq6wA-PtYGnZo9vFVgQnJOGt2pWQ1mTa8XFNhOQk382Q/s400/Datta1.jpg" width="400" /></a></div>
<br />
Trigunatmaka Traimurti Datta is one of the most popular Marathi Aarti of Lord Dattatreya. Lord Dattatreya is also known as Datta who is considered to be an incarnation of the three Hindu gods Brahma, Vishnu and Shiva.<br />
<br />
<h2 style="text-align: center;">
<b>Shri Dattachi Aarti </b></h2>
<div style="text-align: center;">
Trigunatmaka Traimurti Datta Ha Jana।</div>
<div style="text-align: center;">
Triguni Avatara Trailokyarana।</div>
<div style="text-align: center;">
Neti Neti Shabda Na Ye Anumana।</div>
<div style="text-align: center;">
Suravara Munijana Yogi Samadhi Na Ye Dhyana॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Jai Deva Jai Deva Jai Shri Gurudatta।</div>
<div style="text-align: center;">
Aarti Ovalita Harali Bhavachinta॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Sabahya Abhyantari Tu Ek Datta।</div>
<div style="text-align: center;">
Abhagyasi Kaisi Na Kale Hi Maata।</div>
<div style="text-align: center;">
Parahi Paratali Tethe Kaicha Heta।</div>
<div style="text-align: center;">
Janmamaranacha Puralase Anta॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Jai Deva Jai Deva Jai Shri Gurudatta।</div>
<div style="text-align: center;">
Aarti Ovalita Harali Bhavachinta॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Datta Yeuniya Ubha Thakala।</div>
<div style="text-align: center;">
Sadbhave Sashtange Pranipata Kela।</div>
<div style="text-align: center;">
Prasanna Houni Ashirwada Didhala।</div>
<div style="text-align: center;">
Janmamaranacha Phera Chukavila॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Jai Deva Jai Deva Jai Shri Gurudatta।</div>
<div style="text-align: center;">
Aarti Ovalita Harali Bhavachinta॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Datta Datta Aise Lagale Dhyana।</div>
<div style="text-align: center;">
Harapale Mana Jhale Unmana।</div>
<div style="text-align: center;">
Mi Tu Panachi Jhali Bolavana।</div>
<div style="text-align: center;">
Eka Janardani Shri Datta Dhyana॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Jai Deva Jai Deva Jai Shri Gurudatta।</div>
<div style="text-align: center;">
Aarti Ovalita Harali Bhavachinta॥</div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-6442161825703229602016-06-08T02:40:00.001-07:002016-06-08T02:40:33.596-07:00Shri Shankar Aarti<div dir="ltr" style="text-align: left;" trbidi="on">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh15Qzmjfaim0zdl3-Zj-eDf1GZ_RiYP7aoTLjeNfe-ygMBEp4KJgcWmvtZehrK-WHmKGrRalvYewALxVx5CiEPk9MN6d0hB5jwNbom948ifaYFyerqWUaMDQeq5wfeY4ERUnT_dG3z6RQ/s1600/Shankar1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="282" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh15Qzmjfaim0zdl3-Zj-eDf1GZ_RiYP7aoTLjeNfe-ygMBEp4KJgcWmvtZehrK-WHmKGrRalvYewALxVx5CiEPk9MN6d0hB5jwNbom948ifaYFyerqWUaMDQeq5wfeY4ERUnT_dG3z6RQ/s400/Shankar1.jpg" width="400" /></a></div>
<div style="text-align: center;">
<span style="background-color: white;"><br /></span></div>
<div style="text-align: left;">
<span style="background-color: white;"><span style="font-family: "verdana" , "geneva" , "arial" , "book antiqua" , sans-serif; font-size: 14.4px; text-align: justify;">Lavathavati Vikrala Brahmandi Mala</span><span style="font-family: "verdana" , "geneva" , "arial" , "book antiqua" , sans-serif; font-size: 14.4px; text-align: justify;"> is one of the most popular Marathi Aarti of Lord Shiva. This Aarti is recited on most occasions related to Lord Shiva especially on Maha Shivaratri day.</span></span></div>
<h2 style="text-align: center;">
श्री शंकराची आरती </h2>
<div style="text-align: center;">
लवथवती विक्राळा ब्रह्माण्डी माळा।</div>
<div style="text-align: center;">
वीषे कण्ठ काळा त्रिनेत्री ज्वाळा।</div>
<div style="text-align: center;">
लावण्य सुन्दर मस्तकी बाळा।</div>
<div style="text-align: center;">
तेथुनिया जळ निर्मळ वाहे झुळझुळा॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
जय देव जय देव जय श्रीशंकरा।</div>
<div style="text-align: center;">
आरती ओवाळू तुज कर्पुरगौरा॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
कर्पुर्गौरा भोळा नयनी विशाळा।</div>
<div style="text-align: center;">
अर्धांगी पार्वती सुमनांच्या माळा।</div>
<div style="text-align: center;">
विभुतीचे उधळण शितिकण्ठ नीळा।</div>
<div style="text-align: center;">
ऐसा शंकर शोभे उमावेल्हाळा॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
जय देव जय देव जय श्रीशंकरा।</div>
<div style="text-align: center;">
आरती ओवाळू तुज कर्पुरगौरा॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
देवी दैत्यी सागरमन्थन पै केलें।</div>
<div style="text-align: center;">
त्यामाजी अवचित हळाहळ जें उठिले।</div>
<div style="text-align: center;">
ते त्वां असुरपणे प्राशन केलें।</div>
<div style="text-align: center;">
नीलकण्ठ नाम प्रसिद्ध झालें॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
जय देव जय देव जय श्रीशंकरा।</div>
<div style="text-align: center;">
आरती ओवाळू तुज कर्पुरगौरा॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
व्याघ्राम्बर फणिवरधर सुन्दर मदनारी।</div>
<div style="text-align: center;">
पंचानन मनमोहन मुनिजन सुखकारी।</div>
<div style="text-align: center;">
शतकोटीचें बीज वाचे उच्चारी।</div>
<div style="text-align: center;">
रघुकुळटिळक रामदासा अन्तरी॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
जय देव जय देव जय श्रीशंकरा।</div>
<div style="text-align: center;">
आरती ओवाळू तुज कर्पुरगौरा॥</div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-26870822025824111832016-06-08T00:41:00.000-07:002016-06-08T00:41:45.542-07:00Shri Ram Aarti<div dir="ltr" style="text-align: left;" trbidi="on">
<div class="separator" style="clear: both; text-align: center;">
</div>
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgKUoMpckIUN3ixIpX15_nx-bqh9Fldi48xlbb2g3RUIDmHlmJHoH-_cFKD1oBZ0zy9o28_gYSohCpbdzKg3WayMo7jIQEMivWjcsjpB7bL9qghVLg4TE2yfl9JLEq1PrRaxWqfPxGae6g/s1600/Rama1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="300" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgKUoMpckIUN3ixIpX15_nx-bqh9Fldi48xlbb2g3RUIDmHlmJHoH-_cFKD1oBZ0zy9o28_gYSohCpbdzKg3WayMo7jIQEMivWjcsjpB7bL9qghVLg4TE2yfl9JLEq1PrRaxWqfPxGae6g/s400/Rama1.jpg" width="400" /></a></div>
<br />
Tribhuvanamandita Mala Galan is one of the most popular Marathi Aarti of Shri Rama. This Marathi Aarti recites on most occasions related to Lord Rama especially on Rama Navami day.<br />
<br />
<h2 style="text-align: center;">
श्री रामाची आरती </h2>
<div style="text-align: center;">
त्रिभुवनमंडितमाळ गळां।</div>
<div style="text-align: center;">
आरती ओवाळूं पाहूं ब्रह्मपुतळा॥</div>
<div style="text-align: center;">
श्रीराम जय राम जय जय राम।</div>
<div style="text-align: center;">
आरती ओवाळूं पाहूं सुन्दर मेघश्यामा॥</div>
<div style="text-align: center;">
ठकाराचे ठाण वारीं धनुष्यबाण।</div>
<div style="text-align: center;">
मारुती सन्मुख उभा कर जोडून॥</div>
<div style="text-align: center;">
श्रीराम जय राम जय जय राम।</div>
<div style="text-align: center;">
आरती ओवाळूं पाहूं सुन्दर मेघश्यामा॥</div>
<div style="text-align: center;">
भरत शत्रुघ्न दोघे चामर ढाळिती।</div>
<div style="text-align: center;">
स्वर्गाहून देव पुष्पवृष्टि करिती॥</div>
<div style="text-align: center;">
श्रीराम जय राम जय जय राम।</div>
<div style="text-align: center;">
आरती ओवाळूं पाहूं सुन्दर मेघश्यामा॥</div>
<div style="text-align: center;">
रत्नजडित हार वर्णू काय मुकुटी।</div>
<div style="text-align: center;">
आरती ओवाळूं चौदां भुवनांच्या कोटी॥</div>
<div style="text-align: center;">
श्रीराम जय राम जय जय राम।</div>
<div style="text-align: center;">
आरती ओवाळूं पाहूं सुन्दर मेघश्यामा॥</div>
<div style="text-align: center;">
विष्णुदास नामा म्हणे मागतो तूतें।</div>
<div style="text-align: center;">
आरती ओंवाळूं पाहूं सीतापतीतें॥</div>
<div style="text-align: center;">
श्रीराम जय राम जय जय राम।</div>
<div style="text-align: center;">
आरती ओवाळूं पाहूं सुन्दर मेघश्यामा॥</div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-30608824615566513332016-06-06T02:47:00.001-07:002016-06-06T02:47:27.790-07:00Shri Vithoba Aarti<div dir="ltr" style="text-align: left;" trbidi="on">
<div style="text-align: center;">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhl09A9TNqVKNxd-Q30T66ImJM6tLfpOQHlJ8A0lFRWiLuvckyHUBhF5_bXUpKVcZ0I1emXbUvGh5IGU-pXzaoweLfURy7-bf0eBuf7uqJq9Kl0QhM_2cFyfZBpnm5ZO3NNyyeJy-rnGtM/s1600/vithhal.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="300" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhl09A9TNqVKNxd-Q30T66ImJM6tLfpOQHlJ8A0lFRWiLuvckyHUBhF5_bXUpKVcZ0I1emXbUvGh5IGU-pXzaoweLfURy7-bf0eBuf7uqJq9Kl0QhM_2cFyfZBpnm5ZO3NNyyeJy-rnGtM/s400/vithhal.jpg" width="400" /></a></div>
<br /></div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
<h2>
<b>Shri Vithobachi Aarti </b></h2>
</div>
<div style="text-align: center;">
Yuge Aththavis Vitevari Ubha।</div>
<div style="text-align: center;">
Vamangi Rakhumai Dise Divya Shobha।</div>
<div style="text-align: center;">
Pundalikache Bheti Parabrahma Ale Ga।</div>
<div style="text-align: center;">
Charani Vahe Bhima Uddhari Jaga॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Jai Deva Jai Deva Jai Panduranga।</div>
<div style="text-align: center;">
Rakhumai Vallabha Raichya Vallabha Pave Jivalaga॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Tulsimala Gala Kar Thevuni Kati।</div>
<div style="text-align: center;">
Kanse Pitambara Kasturi Lallati।</div>
<div style="text-align: center;">
Deva Suravara Nitya Yeti Bheti।</div>
<div style="text-align: center;">
Garuda Hanumanta Pudhe Ubhe Rahti॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Jai Deva Jai Deva Jai Panduranga।</div>
<div style="text-align: center;">
Rakhumai Vallabha Raichya Vallabha Pave Jivalaga॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Dhanya Venunada Anukshetrapala।</div>
<div style="text-align: center;">
Suvarnachi Kamale Vanamala Galam।</div>
<div style="text-align: center;">
Rahi Rakhumabai Raniya Sakala।</div>
<div style="text-align: center;">
Ovaliti Raja Vithoba Sanvala॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Jai Deva Jai Deva Jai Panduranga।</div>
<div style="text-align: center;">
Rakhumai Vallabha Raichya Vallabha Pave Jivalaga॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Ovalu Aratya Kurvandya Yeti।</div>
<div style="text-align: center;">
Chandrabhagemaji Soduniya Deti।</div>
<div style="text-align: center;">
Dindya Pataka Vaishanava Nachati।</div>
<div style="text-align: center;">
Pandharicha Mahima Varnava Kiti॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Jai Deva Jai Deva Jai Panduranga।</div>
<div style="text-align: center;">
Rakhumai Vallabha Raichya Vallabha Pave Jivalaga॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Ashadhi Kartiki Bhaktajana Yeti।</div>
<div style="text-align: center;">
Chandrabhagemaji Snane Je Kariti।</div>
<div style="text-align: center;">
Darshana Helamatre Tayan Hoya Mukti।</div>
<div style="text-align: center;">
Keshavasi Namadeva Bhave Ovaliti॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Jai Deva Jai Deva Jai Panduranga।</div>
<div style="text-align: center;">
Rakhumai Vallabha Raichya Vallabha Pave Jivalaga॥</div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-86762908079747276402016-05-08T23:08:00.001-07:002016-05-08T23:08:06.573-07:00Hanuman Chalisa and Meaning in English<div dir="ltr" style="text-align: left;" trbidi="on">
<div dir="ltr" style="text-align: left;" trbidi="on">
<div class="separator" style="clear: both; text-align: center;">
<a href="http://amzn.to/21N1kVB" target="_blank"><img alt="Hanuman chalisa" border="0" height="320" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEid1Em_c_8IlCHuRF2hlfrHH4JmMmf_FRL2Kk6lLro0vAtkLkMwftbEvJUOCzPwSupryivfKyiqbsfQE0-UjILMzthtway2C0BiBfjUndq0OR6kjyXt88H7U1IFtduqu9Ourz-yxZNEtlU/s320/hanuman1.jpg" title="" width="320" /></a></div>
<div class="" style="clear: both; text-align: center;">
<br /></div>
<br />
<div style="text-align: justify;">
<strong>sriguru charan saroj raja, nija mana mukuru sudhari</strong></div>
<strong></strong><br />
<div style="text-align: justify;">
<strong><strong>barnau raghbar bimal jasu, jo dayaku phal chari</strong></strong></div>
<strong>
</strong><br />
<div style="text-align: justify;">
<strong><br /></strong></div>
<div style="text-align: justify;">
“After cleaning the mirror of my mind with the dust from my guru’s lotus feet, I recite the pure glory of Sri Rama, which provides the four fruits of life.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<br /></div>
<br />
<div style="text-align: justify;">
<strong>buddhiheen tanu janike, sumiron pavankumar</strong></div>
<strong></strong><br />
<div style="text-align: justify;">
<strong><strong>bal buddhi bidya dehi mohin, harhu kalesa bikar</strong></strong></div>
<strong>
</strong><br />
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“Having understood that I am devoid of intellect, I am remembering Hanuman, the son of Pavan. I request him to grant me intellect, power, and knowledge and to remove my flaws and sufferings.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Notes: The mirror of our mind is covered with the dust of ignorance. But we can clean it with the dust of our guru’s lotus feet. As soon as our mind starts getting purified, it voluntarily aspires to recite the glories of Sri Rama, who has always been living within it. Chanting his name and singing his glories then provides the four aims of life: dharma (righteousness and fulfillment of duties), artha (wealth), kama (pleasures and fulfillment of dreams), and moksha (liberation).</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
If we think we possess the mental faculties to reach Brahman or fully know him, we may be karmically obstructed, at least according to the devotional traditions of Hinduism. Even if we are powerful and knowledgeable, chances are that we may be misusing these resources. Once we understand our own limitations and surrender our self to Hanuman, we can expect him to grant us the intellect, power, and knowledge that can be used for our absolute advancement and to remove the cause of our sufferings.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>jai hanuman jnana guna sagar, jai kapisa tihun loka ujagar ||1||</b></div>
<div style="text-align: justify;">
<b>rama doot atulita bal dhama, anjani putra pavan suta nama ||2||</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“Salutations to Hanuman, the ocean of jnana and virtue; salutations to the king of vanaras, who is renowned in the three worlds, is the messenger of Sri Rama, possesses incomparable strength, and is known as Anjani-putra (“child of Anjani”) and Pavan-putra (“son of wind”).</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>mahavira bikrama bajrangi, kumati nivara sumati ke sangi ||3||</b></div>
<div style="text-align: justify;">
<b>kanchan baran biraj subesa, kanan kundal kunchit kesa ||4||</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“O Hanuman! You are supremely powerful and heroic, have a physique like lightning, ward off evil thoughts, and grant the companionship of wisdom. You possess a golden complexion, wear auspicious attire, are adorned with ear-rings, and have curly hair.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Notes: The chalisa begins with salutations to Hanuman, who, as everyone knows, is the ultimate savior and can bestow all sattvic qualities in beings remembering him. Besides incomparable strength, knowledge, and power, Hanuman also possesses perfection in utilizing his powers only for Rama. The golden complexion of Hanuman is a reflection of his pure devotion for Rama as well as his position as a universal guru.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>haath bajra au dhwaja biraje, kandhe moonj janeu saaje ||5||</b></div>
<div style="text-align: justify;">
<b>sankar suvana kesari nandan, tej pratap maha jag bandan ||6||</b></div>
<div style="text-align: justify;">
<b><br /></b></div>
<div style="text-align: justify;">
“You carry lightning and a flag in your hands and wear a sacred thread over your shoulder. You are Shiva-incarnate and the son of Kesari. The whole world praises you for your brilliance.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>bidyavana guni ati chatur, rama kaja karibe ko aatur ||7||</b></div>
<div style="text-align: justify;">
<b>prabhu charitra sunibe ko rasiya, rama lakhan sita mana basiya ||8||</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“You are extremely intelligent, virtuous, and smart and are always keen to work for Rama. You enjoy listening to Rama’s praise and live in the hearts of Rama, Sita, and Lakshman.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Notes: Though Hanuman is an eternal ocean of knowledge and virtues, Hanuman’s unique stylishness gets highlighted in the Ramayana during his first visit to Lanka (his first major assignment for Rama). The beauty of his divine play is the focus of the Sundar Kand.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Hanuman has been listening to Rama’s praise from all his devotees and to every being’s viewpoint on the Ramayana for ages but is never satisfied. Out of his grace on all souls, he continues to visit places where Rama’s praise is sung by devotees to ensure that we, the imperfect jivas, do not forget Rama-nama. Unsurprisingly, he lives in the hearts of Rama, Sita, and Lakshman, just like they also live in Hanuman’s heart.</div>
<div style="text-align: justify;">
<b><br /></b></div>
<div style="text-align: justify;">
<b>sukshma rupa dhari siyahi dikhawa, bikata rupa dhari lank jarava ||9||</b></div>
<div style="text-align: justify;">
<b>bheem rupa dhari asura sanhare, ramchandra ke kaaj sanware ||10||</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“Though you appeared before Devi Sita in a tiny form, you assumed a fearsome form to burn Lanka. You assumed a gigantic form to annihilate asuras and make preparations for Rama’s divine plan.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>laye sajivan lakhan jiyaye, shriraghubir harashi ur laye||11||</b></div>
<div style="text-align: justify;">
<b>raghupati kinhi bahut badhai, tum mam priye bharathi sam bhai ||12||</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“By bringing the Sanjivani (an herb) to revive Lakshman’s life, you filled Sri Rama’s heart with happiness, who then embraced you. Rama praised you extensively and stated that you are as dear to him as Bharata, his brother.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Notes: Hanuman, who possesses all mystical powers and can change forms, assumed different appearances during his visit to Lanka. When he saw Devi Sita under the Ashoka tree, his form was so weak, tiny, and child-like that the Mother Goddess doubted his potential as a warrior. He then assumed a very frightening form while burning down Lanka, and took a gigantic form to annihilate asuras.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Sri Rama’s comparison of Hanuman with Bharata shows Rama’s impartial affection towards all his devotees. At the same time, the comparison is more a compliment and praise for Bharata than for Hanuman, who, like Rama, is beyond all comparisons and had showered his grace on Bharata as well. Just like Hanuman removed Lakshman’s suffering, he also eliminated Bharata’s suffering forever by informing Bharata about Rama’s arrival near Ayodhya.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>sahas badan tumharo jasa gavein, asa kahi shripati kanth lagavein||13||</b></div>
<div style="text-align: justify;">
<b>sanakadik brahmadi munisa, narad sarad sahit ahisa||14||</b></div>
<div style="text-align: justify;">
<b>jama kuber digpala jahan te, kabi kobid kahi sake kahan te||15||</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“After saying that the thousand-hooded Sheshnaga sings your praise, Rama, the Lord of Shri, embraced you. When Sanaka and his brothers, Brahma and the munis, Narada, Devi Saraswati, Yama, Kubera, and Digpala can not describe your glories, how can poets and scholars describe them?”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Notes: Sheshnaga, the divine serpent who forms the coils on which Narayana rests and who has incarnated on Earth as Lakshmana, is selective in praising others. Besides Sita Rama (or Lakshmi Narayana), it appears that he has found only Hanuman worthy of his praise. Tulasidasa, the ultimate devotional poet, finds all scholars and poets (including himself) unqualified for describing Hanuman’s glories. But he knows that describing the greatness of Hanuman is an unachievable task for even divine beings.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>tum upkara sugreevahi kinha, rama milaye raja pada dinha||16||</b></div>
<div style="text-align: justify;">
<b>tumharo mantra vibhishan mana, lankeshwar bhaye sab jaga jaana||17||</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“As a result of your beneficence, Sugreeva met Rama and got his throne. The world already knows that Vibhishana became the king of Lanka by following your advice.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>juga sahastra jojan par bhanu, leelyo taahi madhur phal jaanu||18||</b></div>
<div style="text-align: justify;">
<b>prabhu mudrika meli mukha maahi, jaladhi langh gaye achraja nahin||19||</b></div>
<div style="text-align: justify;">
<b>durgam kaaj jagat ke jete, sugam anugrah tumhare tete||20||</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“You swallowed the Sun, located thousands if miles away, believing it to be a sweet fruit. It is unsurprising that you jumped over the ocean with Rama’s ring in your mouth. The impossible tasks of the world become easy with your grace.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Notes: Hanuman’s grace on Sugreeva and Vibhishana was similar. Both were more worthy, in terms of dharma, than their respective brothers. As a result of their meeting with Sri Rama, who is the king of the Universe and the sustainer of dharma, both got enthroned in their kingdoms, Kishkindha and Lanka. A face-to-face meeting of a jiva with Rama (darshan) solely falls in Hanuman’s domain, for only he can make is possible for a being.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Though jumping across an ocean or reaching the Sun to engulf it may appear impossible tasks to even seers and gods, nothing is impossible for the incarnation of Shiva who was born to help Para Shakti and Parameshvara in their divine play on Earth.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>rama duare tum rakhware, hota na aagya binu paisare||21||</b></div>
<div style="text-align: justify;">
<b>sab sukh lahe tumhari sarana, tum racchak kahu ko darna||22||</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“You guard the door to Rama’s abode, which no one can enter without your approval. Your refuge provides absolute happiness, and no fears exist with you as one’s protector.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>aapan tej samharo aape, teenon loka haank te kaapen||23||</b></div>
<div style="text-align: justify;">
<b>bhoot pishach nikat nahin aavein, mahavira jab naam sunavein||24||</b></div>
<div style="text-align: justify;">
<b>nase roga hare sab pira, japat nirantar hanumat beera||25||</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“Only you can control your energy and brilliance; the three worlds quiver when you roar. Evil souls do not approach a person who recites the name of Hanuman. The continual chanting of Hanuman’s name removes all diseases and sufferings.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Notes: Hanuman is considered the real guard to Rama’s abode because Hanuman’s blessings are essential for Rama’s grace on a being. Though Hanuman is fully calm, the universe does fear his potential anger. However, a devotee of Hanuman, who is always protected by him, has no reason to fear, for chanting of Hanuman’s name removes all three types of sufferings — spiritual, mental, and physical.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>sankat tein hanuman chhuravai, mana krama bachan dhyana jo lave||26||</b></div>
<div style="text-align: justify;">
<b>sab par rama tapasvi raja, tin ke kaaj sakal tum saaja||27||</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“Whenever someone remembers Hanuman using mind, action, or word, his or her hardships are removed. O Hanuman, you even fulfilled the objectives of Rama, the ultimate yogi who rules over the universe.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Notes: It is advisable to remember Hanuman if one needs help in any sphere of life. If one can not meditate upon him (using the mind) or bow one’s head before his murti (an example of a devotional action), Hanuman can be remembered simply by uttering his name from the mouth. When Hanuman could fulfill the aspirations of Rama, the Supreme Soul, there is no reason why he can not fulfill the aspirations of a weak soul.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>aur manorath jo koi lavai, soi amit jeevan phal paavai||28||</b></div>
<div style="text-align: justify;">
<b>charon jug partap tumhara, hai parsiddha jagat ujiyara||29||</b></div>
<div style="text-align: justify;">
<b>sadhu sant ke tum rakhvare, asura kinandan rama dulare||30||</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“Whoever discloses his or her hopes before you attains incalculable fruits of life. Your brilliance and glory span all the four yugas and brighten up the entire universe. You are the protector of seers and saint, the destroyer of evil beings, and the dearest to Rama.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>ashta siddhi nau nidhi ke data, asa bar deen janaki mata||31||</b></div>
<div style="text-align: justify;">
<b>rama rasayan tumhare paasa, sada raho raghupati ke dasa||32||</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“As a result of a boon from Mother Sita, you can bestow the eight siddhis and nine riches upon anyone. Because you hold the nectar of Rama bhakti, you always remain in Rama’s service.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Notes: Like Bhagavan Shiva, Hanuman can provide immeasurable blessings, both worldly and spiritual, to beings who remember him and share their dreams with him. As a result of a boon given by the Devi Sita, Hanuman can provide all the kinds of mystical powers and riches to his devotee at his discretion. Though Hanuman was born on Earth in treta yoga, his glory spreads beyond time and space. He is, therefore, revered in all the four yugas (even sata yuga) and by everyone in the universe, including divine beings. A major characteristic of Hanuman’s bhakti is his perfection in dasya bhava, more about which can be read here.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>tumhare bhajan rama ko paave, janam janam ke dukh bisrave||33||</b></div>
<div style="text-align: justify;">
<b>ant kaal raghubar pur jayee, jahan janma hari bhakta kahai||34||</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“Your adoration leads a being to Bhagavan Rama, and he or she forgets the sufferings experienced over previous lifetimes. After concluding one’s time on Earth, the being reaches the abode of Rama and eternally remains his devotee.”</div>
<div style="text-align: justify;">
<b><br /></b></div>
<div style="text-align: justify;">
<b>aur devata chit na dharahi, hanumat sei sarba sukh karai||35||</b></div>
<div style="text-align: justify;">
<b>sankat kate mite sab pira, jo sumire hanumat balbira||36||</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“A devotee of Hanuman need not worship any other god, for Hanuman’s devotion is sufficient to grant complete bliss. All misfortunes and pains are eliminated by remembering the supremely powerful Hanuman.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Notes: Some of the perceptible fruits of Hanuman’s bhakti, as summarized by Goswami Tulasidasa, include liberation from the karmic cycle and eternal nearness to Rama. Because Hanuman acts like a guardian, provides all material and spiritual blessings, and eventually hands over an individual soul (jiva) to Rama, the Supreme Soul, Hanuman’s devotees find little need to worship anyone else. The world has not heard of a bigger protector and savior than Hanuman.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>jai jai jai hanuman gosain, kripa karahu guru deva ki nain||37||</b></div>
<div style="text-align: justify;">
<b>jo sat baar path kar koi, chhutahi bandi maha sukh hoi||38||</b></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
“Hail to you, Lord Hanuman! Please grace me as my guru. Whoever recites this prayer a hundred times is liberated from bondage and experiences the greatest joy.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>jo yeh pade hanuman chalisa, hoye siddhi saakhi gaurisa||39||</b></div>
<div style="text-align: justify;">
<b>tulasidasa sada hari chera, kije naath hriday mahan dera||40||</b></div>
<div style="text-align: justify;">
<b><br /></b></div>
<div style="text-align: justify;">
“Whoever reads this Hanuman Chalisa becomes spiritually accomplished; Bhagavan Shiva himself is the witness to this. Tulasidasa is an eternal servant of Sri Rama. O Lord Hanuman! Please dwell in my heart.”</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>pavantanaye sankat haran, mangal murati rupa</b></div>
<div style="text-align: justify;">
<b>rama lakhan sita sahit, hriday basahu sur bhupa</b></div>
<div style="text-align: justify;">
<b><br /></b></div>
<div style="text-align: justify;">
"O son of Pavan! You are the remover of miseries and the embodiment of auspiciousness. Please reside in my heart, O King of gods, with Rama, Lakshmana, and Sita."</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Notes: Hanuman, out of his limitless grace, has stayed on Earth to guide individual souls towards Rama. All Rama devotees, including some of the biggest bhakti saints ever born, have been dependent on Hanuman’s grace for reaching Rama. This explains why Hanuman can be called the ultimate guru for everyone who has or will, in the future, get to utter even a single name of Rama. Though Hanuman’s worship can provide mystical powers as well as immeasurable riches, true bhakti lies in his selfless (nishkama) remembrance. Only then can we expect him to reside in our hearts with Sita-Rama and Lakshmana.<br />
<br /></div>
</div>
<iframe frameborder="0" marginheight="0" marginwidth="0" scrolling="no" src="https://ws-na.amazon-adsystem.com/widgets/q?ServiceVersion=20070822&OneJS=1&Operation=GetAdHtml&MarketPlace=US&source=ss&ref=as_ss_li_til&ad_type=product_link&tracking_id=httppshinde2h-20&marketplace=amazon&region=US&placement=B00R54N970&asins=B00R54N970&linkId=1da45838ddca51a1824ebdafcacab57e&show_border=true&link_opens_in_new_window=true" style="height: 240px; width: 120px;"></iframe></div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com2tag:blogger.com,1999:blog-2751949949822608152.post-35358511060805675412016-05-05T09:52:00.005-07:002016-05-08T22:41:02.359-07:00Shri Ganapati Stotra in Marathi<div dir="ltr" style="text-align: left;" trbidi="on">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEivL9UOtHzFh48bqvMr54nP1PLa3mbW6M4b2pMSdGGObMTKQ8aamop3JmhhruHhS-dVyNKmBStydeKRu0LEAMJRo_-PXigbNPugbTE0ln4AvdOmUnPnv9U9sDK9NSYC4L6sQYzD9dHU8ss/s1600/Ganesh.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEivL9UOtHzFh48bqvMr54nP1PLa3mbW6M4b2pMSdGGObMTKQ8aamop3JmhhruHhS-dVyNKmBStydeKRu0LEAMJRo_-PXigbNPugbTE0ln4AvdOmUnPnv9U9sDK9NSYC4L6sQYzD9dHU8ss/s1600/Ganesh.jpg" /></a></div>
<br />
Shri Ganapati Stotra is the translation of the original Ganapati stotra in Sanskrit ,done by Shridhar Swami, originally written by Narad Muni.<br />
<br />
These are 12 names of God Ganesh. It is said that if anybody recites this stotra daily for a year then he becomes master of all sidhies.<br />
<br />
<div style="text-align: center;">
श्रीगणपती स्तोत्र</div>
<div style="text-align: center;">
साष्टांग नमन हे माझे गौरीपुत्रा विनायका । </div>
<div style="text-align: center;">
भक्तीनें स्मरतो नित्य आयुःकामार्थ साधती ॥ १ ॥</div>
<div style="text-align: center;">
प्रथम नांव वक्रतुंड दुसरें एकदंत ते ।</div>
<div style="text-align: center;">
तिसरे कृष्णपिंगाक्ष चवथे गजवक्र ते ॥ २ ॥</div>
<div style="text-align: center;">
पांचवे श्रीलंबोदर सहावें विकट नांव ते ।</div>
<div style="text-align: center;">
सातवे विघ्नराजेंद्र आठवे धुम्रवर्ण ते ॥ ३ ॥</div>
<div style="text-align: center;">
नववे श्री भालचंद्र दहावे श्री विनायक ।</div>
<div style="text-align: center;">
अकरावे गणपती बारावे श्री गजानन ॥ ४ ॥</div>
<div style="text-align: center;">
देवनांवे अशी बारा तीन संध्या म्हणे नर । </div>
<div style="text-align: center;">
विघ्नभीती नसे त्याला प्रभो ! तू सर्व सिद्धिदे ॥ ५ ॥</div>
<div style="text-align: center;">
विद्यार्थ्याला मिळे विद्या धनार्थ्याला मिळे धन ।</div>
<div style="text-align: center;">
पुत्रार्थ्याला मिळे पुत्र मोक्षार्थ्याला मिळे गति ॥ ६ ॥</div>
<div style="text-align: center;">
जपता गणपती स्तोत्र सहा मासांत हे फळ ।</div>
<div style="text-align: center;">
एक वर्ष पुर्ण होतां मिळे सिद्धी न संशय ॥ ७ ॥</div>
<div style="text-align: center;">
नारदांनी रचिलेले झाले संपू्र्ण स्तोत्र हें ।</div>
<div style="text-align: center;">
श्रीधराने मराठींत पठण्या अनुवादिले ॥ ८ ॥</div>
<div style="text-align: center;">
॥ श्रीगणपती स्तोत्र संपूर्ण ॥</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
<br /></div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-89673987555226467252015-10-19T01:42:00.001-07:002016-05-08T23:28:54.269-07:00Collection of Marathi Stotras<div dir="ltr" style="text-align: left;" trbidi="on">
<br />
<ul style="text-align: left;">
<li><a href="http://marutistotra.blogspot.com/2016/05/shri-ganapati-stotra-in-marathi.html" target="_blank">Shri Ganapati Stotra </a></li>
</ul>
<div>
<br /></div>
<ul style="text-align: left;">
<li><a href="http://marutistotra.blogspot.in/2012/08/maruti-stotra.html" target="_blank">Maruti Stotra</a></li>
</ul>
<br />
<ul style="text-align: left;">
<li><a href="http://marutistotra.blogspot.in/2015/10/manache-shlok.html" target="_blank">Manache Shlok</a></li>
</ul>
<br />
<ul style="text-align: left;">
<li><a href="http://marutistotra.blogspot.com/2015/09/mantra-pushpanjali.html" target="_blank">Mantra Pushpanjali</a></li>
</ul>
<br />
<ul style="text-align: left;">
<li><a href="http://marutistotra.blogspot.in/2015/09/morning-shlokas-for-kids.html" target="_blank">Morning Shlokas For Children</a></li>
</ul>
<br />
<ul style="text-align: left;">
<li><a href="http://marutistotra.blogspot.in/2015/09/gayatri-mantra-meaning-and-benefits.html" target="_blank">Gayatri Mantra</a></li>
</ul>
<br />
<ul style="text-align: left;">
<li><a href="http://marutistotra.blogspot.in/2015/01/ramraksha-stotra-in-marathi.html" target="_blank">Ramraksha Stotra</a></li>
</ul>
<br />
<ul style="text-align: left;">
<li><a href="http://marutistotra.blogspot.in/2015/01/hanuman-chalisa.html" target="_blank">Hanuman chalisa</a></li>
</ul>
<br />
<br />
<br /></div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-33890166243447178652015-10-19T01:26:00.001-07:002016-05-08T22:42:28.411-07:00Manache Shlok<div dir="ltr" style="text-align: left;" trbidi="on">
<div style="text-align: justify;">
<br /></div>
<div style="text-align: center;">
<br /></div>
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEi6ofbTvHwp4_qtqH4GSGnKNoSu_VlI42E5eLshMIm3S0HCKT45k3eviUFzzfhcPNvO8qyKKD9-6ZheYez5UDo9Gz98VtUFmYVrzxEZ5RJ8UlVjiT33INbl-OqWeCluuosm5USBTWo-DiU/s1600/manache+shlok.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEi6ofbTvHwp4_qtqH4GSGnKNoSu_VlI42E5eLshMIm3S0HCKT45k3eviUFzzfhcPNvO8qyKKD9-6ZheYez5UDo9Gz98VtUFmYVrzxEZ5RJ8UlVjiT33INbl-OqWeCluuosm5USBTWo-DiU/s1600/manache+shlok.jpg" /></a></div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
<div style="text-align: left;">
<b style="text-align: justify;">Shri Manache Shlok</b><span style="text-align: justify;"> – these quatrains were composed by</span><a href="https://en.wikipedia.org/wiki/Samarth_Ramdas" style="text-align: justify;" target="_blank"> Samarth Ramdas Swami</a><span style="text-align: justify;">.Ramdas was a devotee of Hanuman and Rama.He is a spiritual poet of Maharashtra."Shri Manāche Shlok" advises ethical behavior and love for God, and a large volume, Dasbodh, provides advice on both spiritual and practical topics.</span></div>
<span style="text-align: justify;"><br /></span></div>
<div style="text-align: center;">
॥ जय जय रघुवीर समर्थ ॥<br />
<br />
श्री रामदासस्वामिंचे मनाचे श्लोक<br />
<br />
गणाधीश जो ईश सर्वा गुणांचा ।<br />
मुळारंभ आरंभ तो निर्गुणाचा ॥<br />
नमूं शारदा मूळ चत्वार वाचा ।<br />
गमू पंथ आनंत या राघवाचा ॥ १ ॥<br />
<br />
मना सज्जना भक्तिपंथेची जावे ।<br />
तरी श्रीहरी पाविजेतो स्वभावे ॥<br />
जनीं निंद्य ते सर्व सोडूनी द्यावे ।<br />
जनीं वंद्य ते सर्व भावे करावे ॥ २ ॥<br />
<br />
प्रभाते मनीं राम चिंतीत जावा ।<br />
पुढे वैखरी राम आधी वदावा ॥<br />
सदाचार हा थोर सांडू नये तो ।<br />
जनीं तोचि तो मानवी धन्य होतो ॥ ३ ॥<br />
<br />
मना वासना दुष्ट कामा न ये रे ।<br />
मना सर्वथा पापबुद्धी नको रे ॥<br />
मना सर्वथा नीति सोडू नको हो ।<br />
मना अंतरी सार वीचार राहो ॥ ४ ॥<br />
<br />
मना पापसंकल्प सोडूनि द्यावा ।<br />
मना सत्य संकल्प जीवी धरावा ॥<br />
मना कल्पना ते नको वीषयांची ।<br />
विकारे घडे हो जनीं सर्व ची ची ॥ ५ ॥<br />
<br />
नको रे मना क्रोध हा खेदकारी ।<br />
नको रे मना काम नाना विकारी ॥<br />
नको रे मना सर्वदा अंगिकारू ।<br />
नको रे मना मत्सरू दंभ भारू ॥ ६ ॥<br />
<br />
मना श्रेष्ठ धारिष्ट जीवी धरावे ।<br />
मना बोलणे नीच सोशीत जावे ॥<br />
स्वये सर्वदा नम्र वाचे वदावे ।<br />
मना सर्व लोकांसि रे नीववावे ॥ ७ ॥<br />
<br />
देहे त्यागिता कीर्ति मागे उरावी ।<br />
मना सज्जना हेचि क्रीया धरावी ॥<br />
मना चंदनाचे परी त्वां झिजावे ।<br />
परी अंतरी सज्जना नीववावे ॥ ८ ॥<br />
<br />
नको रे मना द्रव्य ते पूढिलांचे ।<br />
अति स्वार्थबुद्धी नुरे पाप सांचे ॥<br />
घडे भोगणे पाप ते कर्म खोटे ।<br />
न होता मनासारखे दुःख मोठे ॥ ९ ॥<br />
<br />
सदा सर्वदा प्रीति रामी धरावी ।<br />
सुखाची स्वये सांडि जीवी करावी ॥<br />
देहेदुःख ते सूख मानीत जावे ।<br />
विवेके सदा स्वस्वरूपी भरावे ॥ १० ॥<br />
<br />
जनीं सर्वसूखी असा कोण आहे ।<br />
विचारे मना तूचि शोधूनि पाहे ॥<br />
मना त्वाचि रे पूर्वसंचीत केले ।<br />
त्यासारखे भोगणे प्राप्त झाले ॥ ११ ॥<br />
<br />
मना मानसी दुःख आणू नको रे ।<br />
मना सर्वथा शोक चिंता नको रे ॥<br />
विवेके देहेबुद्धी सोडूनि द्यावी ।<br />
विदेहीपणे मुक्ती भोगीत जावी ॥ १२ ॥<br />
<br />
मना सांग पां रावणां काय जाले ।<br />
अकस्मात ते राज्य सर्वै बुडाले ॥<br />
म्हणोनी कुडी वासना सांडि वेगी ।<br />
बळे लागला काळ हा पाठिलागी ॥ १३ ॥<br />
<br />
जिवा कर्मयोगे जनीं जन्म जाला ।<br />
परी शेवटी काळमूखी निमाला ॥<br />
महाथोर ते मृत्युपंथेचि गेले ।<br />
कितीएक ते जन्मले आणि मेले ॥ १४ ॥<br />
<br />
मना पाहता सत्य हे मृत्युभूमी ।<br />
जितां बोलती सर्वही जीव मी मी ॥<br />
चिरंजीव हे सर्वही मानिताती ।<br />
अकस्मात सांडूनिया सर्व जाती ॥ १५ ॥<br />
<br />
मरे एक त्याचा दुजा शोक वाहे ।<br />
अकस्मात तोही पुढे जात आहे ॥<br />
पुरेना जनीं लोभ रे क्षोभ त्याते ।<br />
म्हणोनी जनीं मागुता जन्म घेते ॥ १६ ॥<br />
<br />
मनी मानवा व्यर्थ चिंता वहाते ।<br />
अकस्मात होणार होऊन जाते ॥<br />
घडे भोगणे सर्वही कर्मयोगे ।<br />
मतीमंद ते खेद मानी वियोगे ॥ १७ ॥<br />
<br />
मना राघवेवीण आशा नको रे ।<br />
मना मानवाची नको कीर्ति तू रे ॥<br />
जया वर्णिती वेद शास्त्रे पुराणे ।<br />
तया वर्णिता सर्वही श्लाघ्यवाणे ॥ १८॥<br />
<br />
मना सर्वथा सत्य सांडू नको रे ।<br />
मना सर्वथा मिथ्य मांडू नको रे ॥<br />
मना सत्य ते सत्य वाचे वदावे ।<br />
मना मिथ्य ते मिथ्य सोडूनि द्यावे ॥ १९ ॥<br />
<br />
बहू हिंपुटी होईजे मायपोटी ।<br />
नको रे मना यातना तेचि मोठी ॥<br />
निरोधे पचे कोंडिले गर्भवासी ।<br />
अधोमूख रे दुःख त्या बाळकासी ॥ २० ॥<br />
<br />
मना वासना चूकवी येरझारा ।<br />
मना कामना सोडि रे द्रव्यदारा ॥<br />
मना यातना थोर हे गर्भवासी ।<br />
मना सज्जना भेटवी राघवासी ॥ २१ ॥<br />
<br />
मना सज्जना हीत माझे करावे ।<br />
रघूनायका दृढ चित्ती धरावे ॥<br />
महाराज तो स्वामि वायुसुताचा ।<br />
जना उद्धरी नाथ लोकत्रयाचा ॥ २२ ॥<br />
<br />
न बाले मना राघवेवीण काही ।<br />
मनी वाउगे बोलता सूख नाही ॥<br />
घडीने घडी काळ आयुष्य नेतो ।<br />
देहांती तुला कोण सोडू पहातो ॥ २३ ॥<br />
<br />
रघूनायकावीण वाया शिणावे ।<br />
जनासारिखे व्यर्थ का वोसणावे ॥<br />
सदा सर्वदा नाम वाचे वसो दे ।<br />
अहंता मनी पापिणी ते नसो दे ॥ २४ ॥<br />
<br />
मना वीट मानू नको बोलण्याचा ।<br />
पुढे मागुता राम जोडेल कैचा ॥<br />
सुखाची घडी लोटता सूख आहे ।<br />
पुढे सर्व जाईल काही न राहे ॥ २५ ॥<br />
<br />
देहेरक्षणाकारणे यत्न केला ।<br />
परी शेवटी काळ घेऊन गेला ॥<br />
करी रे मना भक्ति या राघवाची ।<br />
पुढे अंतरी सोडि चिंता भवाची ॥ २६ ॥<br />
<br />
भवाच्या भये काय भीतोस लंडी ।<br />
धरी रे मना धीर धाकासि सांडी ॥<br />
रघूनायकासारिखा स्वामि शीरी ।<br />
नुपेक्षी कदा कोपल्या दंडधारी ॥ २७ ॥<br />
<br />
दिनानाथ हा राम कोदंडधारी ।<br />
पुढे देखता काळ पोटी थरारी ॥<br />
मना वाक्य नेमस्त हे सत्य मानी ।<br />
नुपेक्षी कदा राम दासाभिमानी ॥ २८ ॥<br />
<br />
पदी राघवाचे सदा ब्रीद गाजे ।<br />
बळे भक्तरीपूशिरी कांबि वाजे ॥<br />
पुरी वाहिली सर्व जेणें विमानी ।<br />
नुपेक्षी कदा राम दासाभिमानी ॥ २९ ॥<br />
<br />
समर्थाचिया सेवका वक्र पाहे ।<br />
असा सर्व भूमंडळी कोण आहे ॥<br />
जयाची लिला वर्णिती लोक तीन्ही ।<br />
नुपेक्षी कदा राम दासाभिमानी ॥ ३० ॥<br />
<br />
महासंकटी सोडिले देव जेणे ।<br />
प्रतापे बळे आगळा सर्वगूणे ॥<br />
जयाते स्मरे शैलजा शूलपाणी ।<br />
नुपेक्षी कदा राम दासाभिमानी ॥ ३१ ॥<br />
<br />
अहल्या शिळा राघवे मुक्त केली ।<br />
पदी लागता दिव्य होऊनि गेली ॥<br />
जया वर्णिता शीणली वेदवाणी ।<br />
नुपेक्षी कदा राम दासाभिमानी ॥ ३२ ॥<br />
<br />
वसे मेरुमांदार हे सृष्टिलीला ।<br />
शशी सूर्य तारांगणे मेघमाला ॥<br />
चिरंजीव केले जनीं दास दोन्ही ।<br />
नुपेक्षी कदा राम दासाभिमानी ॥ ३३ ॥<br />
<br />
उपेक्षी कदा रामरूपी असेना ।<br />
जिवा मानवा निश्चयो तो वसेना ॥<br />
शिरी भार वाहेन बोले पुराणी ।<br />
नुपेक्षी कदा राम दासाभिमानी ॥ ३४ ॥<br />
<br />
असे हो जया अंतरी भाव जैसा ।<br />
वसे हो तया अंतरी देव तैसा ॥<br />
अनन्यास रक्षीतसे चापपाणी ।<br />
नुपेक्षी कदा राम दासाभिमानी ॥ ३५ ॥<br />
<br />
सदा सर्वदा देव सन्नीध आहे ।<br />
कृपाळूपणे अल्प धारिष्ट पाहे ॥<br />
सुखानंद आनंद कैवल्यदानी ।<br />
नुपेक्षी कदा राम दासाभिमानी ॥ ३६ ॥<br />
<br />
सदा चक्रवाकासि मार्तंड जैसा ।<br />
उडी घालितो संकटी स्वामि तैसा ॥<br />
हरीभक्तिचा घाव गाजे निशाणी ।<br />
नुपेक्षी कदा राम दासाभिमानी ॥ ३७ ॥<br />
<br />
मना प्रार्थना तूजला एक आहे ।<br />
रघूराज थक्कीत होऊनि पाहे ॥<br />
अवज्ञा कदा हो यदर्थी न कीजे ।<br />
मना सज्जना राघवी वस्ति कीजे ॥ ३८ ॥<br />
<br />
जया वर्णिती वेद शास्त्रे पुराणे ।<br />
जयाचेनि योगे समाधान बाणे ॥<br />
तयालागि हे सर्व चांचल्य दीजे ।<br />
मना सज्जना राघवी वस्ति कीजे ॥ ३९ ॥<br />
<br />
मना पाविजे सर्वही सूख जेथे ।<br />
अती आदरे ठेविजे लक्ष तेथे ॥<br />
विविके कुडी कल्पना पालटीजे ।<br />
मना सज्जना राघवी वस्ति कीजे ॥ ४० ॥<br />
<br />
बहू हिंडता सौख्य होणार नाही ।<br />
शिणावे परी नातुडे हीत काही ॥<br />
विचारे बरे अंतरा बोधवीजे ।<br />
मना सज्जना राघवी वस्ति कीजे ॥ ४१ ॥<br />
<br />
बहुतांपरी हेचि आता धरावे ।<br />
रघूनायका आपुलेसे करावे ॥<br />
दिनानाथ हे तोडरी ब्रीद गाजे ।<br />
मना सज्जना राघवी वस्ति कीजे ॥ ४२ ॥<br />
<br />
मना सज्जना एक जीवी धरावे ।<br />
जनीं आपुले हीत तुवां करावे ॥<br />
रघूनायकावीण बोलो नको हो ।<br />
सदा मानसी तो निजघ्यास राहो ॥ ४३ ॥<br />
<br />
मना रे जनीं मौनमुद्रा धरावी ।<br />
कथा आदरे राघवाची करावी ॥<br />
नसे रामे ते धाम सोडूनि द्यावे ।<br />
सुखालागि आरण्य सेवीत जावे ॥ ४४ ॥<br />
<br />
जयाचेनि संगे समाधान भंगे ।<br />
अहंता अकस्मात येउनि लागे ॥<br />
तये संगतीची जनीं कोण गोडी ।<br />
जिये संगतीने मती राम सोडी ॥ ४५ ॥<br />
<br />
मना जे घडी राघवेवीण गेली ।<br />
जनीं आपुली ते तुवा हानि केली ॥<br />
रघूनायकावीण तो शीण आहे ।<br />
जनीं दक्ष तो लक्ष लावूनि पाहे ॥ ४६ ॥<br />
<br />
मनीं लोचनी श्रीहरी तोचि पाहे ।<br />
जनीं जाणता मुक्त होऊनि राहे ॥<br />
गुणी प्रीति राखे क्रमूं साधनाचा ।<br />
जगी धन्य तो दास सर्वोत्तमाचा ॥ ४७ ॥<br />
<br />
सदा देवकाजी झिजे देह ज्याचा ।<br />
सदा रामनामे वदे सत्य साचा ॥<br />
स्वधर्मेचि चाले सदा उत्तमाचा ।<br />
जगी धन्य तो दास सर्वोत्तमाचा ॥ ४८ ॥<br />
<br />
सदा बोलण्यासारिखे चालताहे ।<br />
अनेकी सदा एक देवासि पाहे ॥<br />
सगूणी भजे लेश नाही भ्रमाचा ।<br />
जगी धन्य तो दास सर्वोत्तमाचा ॥ ४९ ॥<br />
<br />
नसे अंतरी काम नानाविकारी ।<br />
उदासीन जो तापसी ब्रह्मचारी ॥<br />
निवाला मनीं लेश नाही तमाचा ।<br />
जगी धन्य तो दास सर्वोत्तमाचा ॥ ५० ॥<br />
<br />
मदे मत्सरे सांडिली स्वार्थबुद्धी ।<br />
प्रपंचीक नाही जयाते उपाधी ॥<br />
सदा बोलणे नम्र वाचा सुवाचा ।<br />
जगी धन्य तो दास सर्वोत्तमाचा ॥ ५१ ॥<br />
<br />
क्रमी वेळ जो तत्त्वचिंतानुवादे ।<br />
न लिंपे कदा दंभ वादे विवादे ॥<br />
करी सूखसंवाद जो ऊगमाचा ।<br />
जगी धन्य तो दास सर्वोत्तमाचा ॥ ५२ ॥<br />
<br />
सदा आर्जवी प्रीय जो सर्व लोकी ।<br />
सदा सर्वदा सत्यवादी विवेकी ॥<br />
न बोले कदा मिथ्य वाचा त्रिवाचा ।<br />
जगी धन्य तो दास सर्वोत्तमाचा ॥ ५३ ॥<br />
<br />
सदा सेवि आरण्य तारुण्यकाळी ।<br />
मिळेना कदा कल्पनेचेनि मेळी ॥<br />
चळेना मनी निश्चयो दृढ ज्याचा ।<br />
जगी धन्य तो दास सर्वोत्तमाचा ॥ ५४ ॥<br />
<br />
नसे मानसी नष्ट आशा दुराशा ।<br />
वसे अंतरी प्रेमपाशा पिपाशा ॥<br />
ऋणी देव हा भक्तिभावे जयाचा ।<br />
जगी धन्य तो दास सर्वोत्तमाचा ॥ ५५ ॥<br />
<br />
दिनाचा दयाळू मनाचा मवाळू ।<br />
स्नेहाळू कृपाळू जनीं दासपाळू ॥<br />
तया अंतरी क्रोध संताप कैचा ।<br />
जगी धन्य तो दास सर्वोत्तमाचा ॥ ५६ ॥<br />
<br />
जगी होइजे धन्य या रामनामे ।<br />
क्रिया भक्ति ऊपासना नित्य नेमें ॥<br />
उदासीनता तत्त्वता सार आहे ।<br />
सदा सर्वदा मोकळी वृत्ति राहे ॥ ५७ ॥<br />
<br />
नको वासना वीषयी वृत्तिरूपे ।<br />
पदार्थी जडे कामना पूर्वपापे ॥<br />
सदा राम निष्काम चिंतीत जावा ।<br />
मना कल्पनालेश तोहि नसावा ॥ ५८ ॥<br />
<br />
मना कल्पना कल्पिता कल्पकोटी ।<br />
नव्हे रे नव्हे सर्वथा रामभेटी ॥<br />
मनी कामना राम नही जयाला ।<br />
अती आदरे प्रीति नाहि तयाला ॥ ५९ ॥<br />
<br />
मना राम कल्पतरू कालधेनू ।<br />
निधी सार चिंतामणी काय वानू ॥<br />
जयाचेनि योगे घडे सर्व सत्ता ।<br />
तया साम्यता कायसी कोण आता ॥ ६० ॥<br />
<br />
उभा कल्पवृक्षातळू दुःख वाहे ।<br />
तया अंतरी सर्वदा तेचि आहे ॥<br />
जनीं सज्जनीं वाद हा वाढवा ।<br />
पुढे मागता शोक जीवी धरावा ॥ ६१ ॥<br />
<br />
निजध्यास तो सर्व तूटोनी गेला ।<br />
बळे अंतरी शोक संताप ठेला ॥<br />
सुखानंद आनंद भेदे बुडाला ।<br />
मना निश्चयो सर्व खेदे उडाला ॥ ६२ ॥<br />
<br />
घरी कामधेनू पुढे ताक मागे ।<br />
हरीबोध सांडोनि वेवाद लागे ॥<br />
करी सार चिंतामणी काचखंडे ।<br />
तया मागता देत आहे उदंडे ॥ ६३ ॥<br />
<br />
अती मूढ त्या दृढ बुद्धी असेना ।<br />
अती काम त्या राम चित्ती वसेना ॥<br />
अती लोभ त्या क्षोभ होईल जाणा ।<br />
अती वीषयी सर्वदा दैन्यवाणा ॥ ६४ ॥<br />
<br />
नको दैन्यवाणे जिणे भक्तिऊणे ।<br />
अती मूर्ख त्या सर्वदा दुःख दूणे ॥<br />
धरी रे मना आदरे प्रीति रामी ।<br />
नको वासना हेमधामी विरामी ॥ ६५ ॥<br />
<br />
नव्हे सार संसार हा घोर आहे ।<br />
मना सज्जना सत्य शोधूनि पाहे ॥<br />
जनीं वीष खाता पुढे सूख कैचे ।<br />
करी रे मना ध्यान या राघवाचे ॥ ६६ ॥<br />
<br />
घनश्याम हा राम लावण्यरूपी ।<br />
महाधीर गंभीर पूर्णप्रतापी ॥<br />
करी संकटी सेवकांचा कुडावा ।<br />
प्रभाते मनी राम चिंतीत जावा ॥ ६७ ॥<br />
<br />
बळे आगळा राम कोदंडधारी ।<br />
महाकाळ विक्राळ तोही थरारी ॥<br />
पुढे मानवा किंकरा कोण केवा ।<br />
प्रभाते मनी राम चिंतीत जावा ॥ ६८ ॥<br />
<br />
सुखानंदकारी निवारी भयाते ।<br />
जनीं भक्तिभावे भजावे तयाते ॥<br />
विवेके त्यजावा अनाचार हेवा ।<br />
प्रभाते मनी राम चिंतीत जावा ॥ ६९ ॥<br />
<br />
सदा रामनामे वदा पूर्णकामे ।<br />
कदा बाधिजेना पदा नित्य नेमे ॥<br />
मदालस्य हा सर्व सोडोनि द्यावा ।<br />
प्रभाते मनी राम चिंतीत जावा ॥ ७० ॥<br />
<br />
जयाचेनि नामे महादोष जाती ।<br />
जयाचेनि नामे गती पाविजेती ॥<br />
जयाचेनि नावे घडे पुण्यठेवा ।<br />
प्रभाते मनी राम चिंतीत जावा ॥ ७१ ॥<br />
<br />
न वेचे कदा ग्रंथची अर्थ काही ।<br />
मुखे नाम उच्चारिता कष्ट नाही ॥<br />
महाघोर संसारशत्रू जिणावा ।<br />
प्रभाते मनी राम चिंतीत जावा ॥ ७२ ॥<br />
<br />
देहेदंडणेचे महादुःख आहे ।<br />
महादुःख ते नाम घेता न राहे ॥<br />
सदाशीव चिंतीतसे देवदेवा ।<br />
प्रभाते मनी राम चिंतीत जावा ॥ ७३ ॥<br />
<br />
बहुतांपरी संकटे साधनांची ।<br />
व्रते दान उद्यापने ती धनाची ॥<br />
दिनाचा दयाळू मनी आठवावा ।<br />
प्रभाते मनी राम चिंतीत जावा ॥ ७४ ॥<br />
<br />
समस्तांमधे सार साचार आहे ।<br />
कळेना तरी सर्व शोधूत पाहे ॥<br />
जिवा असंशयो वाऊगा तो त्यजावा ।<br />
प्रभाते मनी राम चिंतीत जावा ॥ ७५ ॥<br />
<br />
नव्हे कर्म ना धर्म ना योग काही ।<br />
नव्हे भोग ना त्याग ना सांग पाही ॥<br />
म्हणे दास विश्वास नामी धरावा ।<br />
प्रभाते मनी राम चिंतीत जावा ॥ ७६ ॥<br />
<br />
करी काम निष्काम या राघवाचे ।<br />
करी रूप स्वरूप सर्वां जिवांचे ॥<br />
करी छंद निर्द्वंद्व हे गूण गाता ।<br />
हरीकीर्तनी वृत्तिविश्वास होता ॥ ७७ ॥<br />
<br />
अहो ज्या नरा रामविश्वास नाही ।<br />
तया पामरा बाधिजे सर्व काही ॥<br />
महाराज तो स्वामि कैवल्यदाता ।<br />
वृथा वाहणे देहसंसारचिंता ॥ ७८ ॥<br />
<br />
मना पावना भावना राघवाची ।<br />
धरी अंतरी सोडि चिंता भवाची ॥<br />
भवाची जिवा मानवा भूलि ठेली ।<br />
नसे वस्तुची धारणा व्यर्थ गेली ॥ ७९ ॥<br />
<br />
धरा श्रीवरा त्या हरा अंतराते ।<br />
तरा दुस्तरा त्या परा सागराते ॥<br />
सरा वीसरा त्या भरा दुर्भराते ।<br />
करा नीकरा त्या खरा मत्सराते ॥ ८० ॥<br />
<br />
मना मत्सरे नाम सांडू नको हो ।<br />
अती आदरे हा निजध्यास राहो ॥<br />
समस्तांमधे नाम हे सार आहे ।<br />
दुजी तूळणा तूळिताही न साहे ॥ ८१ ॥<br />
<br />
बहू नाम या रामनामी तुळेना ।<br />
अभाग्या नरा पामरा हे कळेना ॥<br />
विषा औषधा घेतले पार्वतीशे ।<br />
जिवा मानवा किंकरा कोण पूसे ॥ ८२ ॥<br />
<br />
जेणे जाळिला काम तो राम ध्यातो ।<br />
उमेसी अती आदरे गूण गातो ॥<br />
बहु ज्ञान वैराग्य सामर्थ्य जेथे ।<br />
परी अंतरी नामविश्वास तेथे ॥ ८३ ॥<br />
<br />
विठोने शिरी वाहिला देवराणा ।<br />
तया अंतरी ध्यास रे त्यासि नेणा ॥<br />
निवाला स्वये तापसी चंद्रमौळी ।<br />
जिवा सोडवी राम हा अंतकाळी ॥ ८४ ॥<br />
<br />
भजा राम विश्राम योगेश्वरांचा ।<br />
जपू नेमिला नेम गौरीहराचा ॥<br />
स्वये नीववी तापसी चंद्रमौळी ।<br />
तुम्हां सोडवी राम हा अंतकाळी ॥ ८५ ॥<br />
<br />
मुखी राम विश्राम तेथेचि आहे ।<br />
सदानंद आनंद सेवोनि आहे ॥<br />
तयावीण तो शीण संदेहकारी ।<br />
निजधाम हे नाम शोकापहारी ॥ ८६ ॥<br />
<br />
मुखी राम त्या काम बाधू शकेना ।<br />
गुणे इष्ट धारिष्ट त्याचे चुकेना ॥<br />
हरीभक्त तो शक्त कामास भारी ।<br />
जगी धन्य तो मारुती ब्रह्मचारी ॥ ८६ ॥<br />
<br />
बहू चांगले नाम या राघवाचे ।<br />
अती साजिरे स्वल्प सोपे फुकाचे ॥<br />
करी मूळ निर्मूळ घेता भवाचे ।<br />
जिवा मानवा हेचि कैवल्य साचे ॥ ८८ ॥<br />
<br />
जनीं भोजनीं नाम वाचे वदावे ।<br />
अती आदरे गद्यघोषे म्हणावे ॥<br />
हरीचिंतने अन्न सेवीत जावे ।<br />
तरी श्रीहरी पाविजेतो स्वभावे ॥ ८९ ॥<br />
<br />
न ये राम वाणी तया थोर हाणी ।<br />
जनीं व्यर्थ प्राणी तया नाम कोणी ॥<br />
हरीनाम हे वेदशास्त्री पुराणी ।<br />
बहू आगळे बोलिली व्यासवाणी ॥ ९० ॥<br />
<br />
नको वीट मानू रघूनायकाचा ।<br />
अती आदरे बोलिजे राम वाचा ॥<br />
न वेचे मुखी सापडे रे फुकाचा ।<br />
करी घोष त्या जानकीवल्लभाचा ॥ ९१ ॥<br />
<br />
अती आदरे सर्वही नामघोषे ।<br />
गिरीकंदरी जाईजे दूरि दोषे ॥<br />
हरी तिष्ठतू तोषला नामघोषे ।<br />
निशेषे हरामानसी रामपीसे ॥ ९२ ॥<br />
<br />
जगी पाहता देव हा अन्नदाता ।<br />
तया लागली तत्त्वता सार चिंता ॥<br />
तयाचे मुखी नाम घेता फुकाचे ।<br />
मना सांग पा रे तुझे काय वेचे ॥ ९३ ॥<br />
<br />
तिन्ही कोप जाळू शके कोप येता ।<br />
निवाला हरू तो मुखे नाम घेता ॥<br />
जपे आदरे पार्वती विश्वमाता ।<br />
म्हणोनी म्हणा तेचि हे नाम आता ॥ ९४ ॥<br />
<br />
अजामेळ पापी वदे पुत्रकामे ।<br />
तया मुक्ति नारायणाचेनि नामे ॥<br />
शुकाकारणे कुंटणी राम वाणी ।<br />
मुखे बोलिता ख्याति जाली पुराणी ॥ ९५ ॥<br />
<br />
महाभक्त प्रल्हाद हा दैत्यकूळी ।<br />
जपे रामनामावळी नित्यकाळी ॥<br />
पिता पापरूपी तया देखवेना ।<br />
जनीं दैत्य तो नाम मूखे म्हणेना ॥ ९६ ॥<br />
<br />
मुखी नाम नीही तया मुक्ति कैची ।<br />
अहंतागुणे यातना ते फुकाची ॥<br />
पुढे अंत येईल तो दैन्यवाणा ।<br />
म्हणोनी म्हणा रे म्हणा देवराणा ॥ ९७ ॥<br />
<br />
हरीनाम नेमस्त पाषाण तारी ।<br />
बहू तारिले मानवी देहधारी ॥<br />
तया रामनामी सदा जो विकल्पी ।<br />
वदेना कदा जीव तो पापरूपी ॥ ९८ ॥<br />
<br />
जगी धन्य वाराणसी पुण्यराशी ।<br />
तयेमाजि आता गती पूर्वजांसी ॥<br />
मुखे रामनामावळी नित्यकाळी ।<br />
जिवा हीत सांगे सदा चंद्रमौळी ॥ ९९ ॥<br />
<br />
यथासांग रे कर्म तेही घडेना ।<br />
घडे धर्म ते पुण्यगाठी पडेना ॥<br />
दया पाहता सर्व भूती असेना ।<br />
फुकाचे मुखी नाम तेही वसेना ॥ १०० ॥<br />
<br />
जया नावडे नाम त्या यम जाची ।<br />
विकल्पे उठे तर्क त्या नर्क ची ची ॥<br />
म्हणोनी अती आदरे नाम घ्यावे ।<br />
मुखे बोलता दोष जाती स्वभावे ॥ १०१ ॥<br />
<br />
अती लीनता सर्वभावे स्वभावे ।<br />
जना सज्जनालागि संतोषवावे ॥<br />
देहे कारणी सर्व लावीत जावे ।<br />
सगूणी अती आदरेसी भजावे ॥ १०२ ॥<br />
<br />
हरीकीर्तनी प्रीति रामी धरावी ।<br />
देहेबुद्धि नीरूपणी वीसरावी ॥<br />
परद्रव्य आणीक कांता परावी ।<br />
यदर्थी मना सांडि जीवी करावी ॥ १०३ ॥<br />
<br />
क्रियेवीण नानापरी बोलिजेते ।<br />
परी चित्त दुश्चित्त ते लाजवीते ॥<br />
मना कल्पना धीट सैराट धावे ।<br />
तया मानवा देव कैसेनि पावे ॥ १०४ ॥<br />
<br />
विवेके क्रिया आपुली पालटावी ।<br />
अती आदरे शुद्ध क्रीया धरावी ॥<br />
जनीं बोलण्यासारिखे चाल बापा ।<br />
मना कल्पना सोडि संसारतापा ॥ १०५ ॥<br />
<br />
बरी स्नानसंध्या करी एकनिष्ठा ।<br />
विवेके मना आवरी स्थानभ्रष्टा ॥<br />
दया सर्वभूती जया मानवाला ।<br />
सदा प्रेमळू भक्तिभावे निवाला ॥ १०६ ॥<br />
<br />
मना कोप आरोपणा ते नसावी ।<br />
मना बुद्धि हे साधुसंगी वसावी ॥<br />
मना नष्ट चांडाळ तो संग त्यागी ।<br />
मना होइ रे मोक्षभागी विभागी ॥ १०७ ॥<br />
<br />
मना सर्वदा सज्जनाचेनि योगे ।<br />
क्रिया पालटे भक्तिभावार्थ लागे ॥<br />
क्रियेवीण वाचाळता ते निवारी ।<br />
तुटे वाद संवाद तो हीतकारी ॥ १०८ ॥<br />
<br />
जनीं वादवेवाद सोडूनि द्यावा ।<br />
जनीं वादसंवाद सूखे करावा ॥<br />
जगी तोचि तो शोकसंतापहारी ।<br />
तुटे वाद संवाद तो हीतकारी ॥ १०९ ॥<br />
<br />
तुटे वाद संवाद त्याते म्हणावे ।<br />
विवेके अहंभाव याते जिणावे ॥<br />
अहंतागुणे वाद नाना विकारी ।<br />
तुटे वाद संवाद तो हीतकारी ॥ ११० ॥<br />
<br />
हिताकारणे बोलणे सत्य आहे ।<br />
हिताकारणे सर्व शोधूनि पाहे ॥<br />
हिताकारणे बंड पाखांड वारी ।<br />
तुटे वाद संवाद तो हीतकारी ॥ १११ ॥<br />
<br />
जनीं सांगता ऐकता जन्म गेला ।<br />
परी वादवेवाद तैसाचि ठेला ॥<br />
उठे संशयो वाद हा दंभधारी ।<br />
तुटे वाद संवाद तो हीतकारी ॥ ११२ ॥<br />
<br />
जनीं हीत पंडीत सांडीत गेले ।<br />
अहंतागुणे ब्रह्मराक्षस जाले ॥<br />
तयाहून व्युत्पन्न तो कोण आहे ।<br />
मना सर्व जाणीव सांडूनि राहे ॥ ११३ ॥<br />
<br />
फुकाचे मुखी बोलता काय वेचे ।<br />
दिसंदीस अभ्यंतरी गर्व सांचे ॥<br />
क्रियेवीण वाचाळता व्यर्थ आहे ।<br />
विचारे तुझा तूचि शोधूनि पाहे ॥ ११४ ॥<br />
<br />
तुटे वाद संवाद तेथे करावा ।<br />
विवेके अहंभाव हा पालटावा ॥<br />
जनीं बोलण्यासारखे आचरावे ।<br />
क्रियापालटे भक्तिपंथेचि जावे ॥ ११५ ॥<br />
<br />
बहू शापिता कष्टला अंबऋषी ।<br />
तयाचे स्वये श्रीहरी जन्म सोशी ॥<br />
दिला क्षीरसिंधु तया ऊपमानी ।<br />
नुपेक्षी कदा देव भक्ताभिमानी ॥ ११६ ॥<br />
<br />
धुरू लेंकरु बापुडे दैन्यवाणे ।<br />
कृपा भाकिता दीघली भेटि जेणे ॥<br />
चिरंजीव तारांगणी प्रेमखाणी ।<br />
नुपेक्षी कदा देव भक्ताभिमानी ॥ ११७ ॥<br />
<br />
गजेदू महासंकटी वास पाहे ।<br />
तयाकारणे श्रीहरी धावताहे ॥<br />
उडी घातली जाहला जीवदानी ।<br />
नुपेक्षी कदा देव भक्ताभिमानी ॥ ११८ ॥<br />
<br />
अजामेळ पापी तया अंत आला ।<br />
कृपाळूपणे तो जनीं मुक्त केला ॥<br />
अनाथासि आधार हा चक्रपाणी ।<br />
नुपेक्षी कदा देव भक्ताभिमानी ॥ ११९ ॥<br />
<br />
विधीकारणे जाहला मत्स्य वेगी ।<br />
धरी कूर्मरूपे धरा पृष्ठभागी ॥<br />
जना रक्षणाकारणे नीच योनी ।<br />
नुपेक्षी कदा देव भक्ताभिमानी ॥ १२० ॥<br />
<br />
महाभक्त प्रल्हाद हा कष्टवीला ।<br />
म्हणोनि तयाकारणे सिंह जाला ॥<br />
न ये ज्वाळ वीशाळ सन्नीध कोणी ।<br />
नुपेक्षी कदा देव भक्ताभिमानी ॥ १२१ ॥<br />
<br />
कृपा भाकिता जाहला वज्रपाणी ।<br />
तया कारणे वामनू चक्रपाणी ॥<br />
द्विजांकारणे भार्गवू चापपाणी ।<br />
नुपेक्षी कदा देव भक्ताभिमानी ॥ १२२ ॥<br />
<br />
अहल्येसतीलागी आरण्यपंथे ।<br />
कुडावा पुढे देव बंदी तयाते ॥<br />
बळे सोडिता घाव घाली निशाणी ।<br />
नुपेक्षी कदा देव भक्ताभिमानी ॥ १२३ ॥<br />
<br />
तये द्रौपदीकारणे लागवेगे ।<br />
त्वरे धावतो सर्व सांडूनि मागे ॥<br />
कळीलागि जाला असे बौद्ध मौनी ।<br />
नुपेक्षी कदा देव भक्ताभिमानी ॥ १२४ ॥<br />
<br />
अनाथां दिनींकारणे जन्मताहे ।<br />
कलंकी पुढे देव होणार आहे ॥<br />
तया वर्णिता शीणली वेदवाणी ।<br />
नुपेक्षी कदा देव भक्ताभिमानी ॥ १२५ ॥<br />
<br />
जनांकारणे देव लीलावतारी ।<br />
बहुतांपरी आदरे वेषधारी ॥<br />
तया नेणती ते जन पापरूपी ।<br />
दुरात्मे महानष्ट चांडाळ पापी ॥ १२६ ॥<br />
<br />
जगी धन्य तो राममूखे निवाला ।<br />
कथा ऐकता सर्व तल्लीन जाला ॥<br />
देहेभावना रामबोधे उडाली ।<br />
मनोवासना रामरूपी बुडाली ॥ १२७ ॥<br />
<br />
मना वासना वासुदेवी वसो दे ।<br />
मना वासना कामसंगी नसो दे ॥<br />
मना कल्पना वाउगी ते न कीजे ।<br />
मना सज्जनीं वस्ति कीजे ॥ १२८ ॥<br />
<br />
गतीकारणे संगती सज्जनाची ।<br />
मती पालटे सूमती दुर्जनाची ॥<br />
रतीनायिकेचा पती नष्ट आहे ।<br />
म्हणोनी मनातीत होवोनी राहे ॥ १२९ ॥<br />
<br />
मना अल्प संकल्प तोही नसावा ।<br />
सदा सत्यसंकल्प चित्ती वसावा ॥<br />
जनीं जल्प वीकल्प तोही त्यजावा ।<br />
रमाकांत एकांतकाळी भजावा ॥ १३० ॥<br />
<br />
भजावा जनीं पाहता राम एकू ।<br />
करी बाण एकू मुखी शब्द एकू ॥<br />
क्रिया पाहता उद्धरे सर्व लोकू ।<br />
धरा जानकीनायकाचा विनेकू ॥ १३१ ॥<br />
<br />
विचारूनि बोले विवंचूनि चाले ।<br />
तयाचेनि संतप्त तेही निवाले ॥<br />
बरे शोधल्यावीण बोलो नको हो ।<br />
जनीं चालणे शुद्ध नेमस्त राहो ॥ १३२ ॥<br />
<br />
हरीभक्त वीरक्त विज्ञान राशी ।<br />
जेणे मानसी स्थापिले निश्चयासी ॥<br />
तया दर्शने स्पर्शते पुण्य जोडे ।<br />
तया भाषणे नष्ट संदेह मोडे ॥ १३३ ॥<br />
<br />
नसे गर्व आंगी सदा वीतरागी ।<br />
क्षमा शांति भोगी दयादक्ष योगी ॥<br />
नसे लोभ ना क्षोभ ना दैन्यवाणा ।<br />
इही लक्षणी जाणिजे योगिराणा ॥ १३४ ॥<br />
<br />
धरी रे मना संगती सज्जनीची ।<br />
जेणे वृत्ति हे पालटे दुर्जनाची ॥<br />
बळे भाव सद्बुद्धि सन्मार्ग लागे ।<br />
महाक्रूर तो काळ विक्राळ भंगे ॥ १३५ ॥<br />
<br />
भये व्यापिले सर्व ब्रह्मांड आहे ।<br />
भयातीत ते संत आनंत पाहे ॥<br />
जया पाहता द्वैत काही दिसेना ।<br />
भयो मानसी सर्वथाही असेना ॥ १३६ ॥<br />
<br />
जिवा श्रेष्ठ ते स्पष्ट सांगोनि गेले ।<br />
परी जीव अज्ञान तैसेचि ठेले ॥<br />
देहेबुद्धिचे कर्म खोटे टळेना ।<br />
जुने ठेवणे मीपणे आकळेना ॥ १३७ ॥<br />
<br />
भ्रमे नाढळे वित्त ते गुप्त जाले ।<br />
जिवा जन्मदारिद्र्य ठाकूनि आले ॥<br />
देहेबुद्धिचा निश्चयो ज्या टळेना ।<br />
जुने ठेवणे मीपणे आकळेना ॥ १३८ ॥<br />
<br />
पुढे पाहता सर्वही कोंदलेसे ।<br />
अभाग्यास हे दृश्य पाषाण भासे ॥<br />
अभावे कदा पुण्य गाठी पडेना ।<br />
जुने ठेवणे मीपणे आकळेना ॥ १३९ ॥<br />
<br />
जयाचे तया चूकले प्राप्त नाही ।<br />
गुणे गोविले जाहले दुःख देही ॥<br />
गुणावेगळी वृत्ति तेही वळेना ।<br />
जुने ठेवणे मीपणे आकळेना ॥ १४० ॥</div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-11689252584869977512015-10-06T04:18:00.003-07:002016-05-08T22:42:42.425-07:00Dasara Festival in India<div dir="ltr" style="text-align: left;" trbidi="on">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjEs6UaVRKqkxGj0BndLFU9NbCgMDfX76_spppDGLL-fnpdl7SxsbkCXlovvS47a40MZgC0AN6xglcWUxEXZMKSDUQ-QY7x_wn9vl_GHrB5i5L87SQvu1Kks1OiAt-e7gfIL4d7rsx9uko/s1600/1711_dussehra-wallpaper-08.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="250" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjEs6UaVRKqkxGj0BndLFU9NbCgMDfX76_spppDGLL-fnpdl7SxsbkCXlovvS47a40MZgC0AN6xglcWUxEXZMKSDUQ-QY7x_wn9vl_GHrB5i5L87SQvu1Kks1OiAt-e7gfIL4d7rsx9uko/s400/1711_dussehra-wallpaper-08.jpg" width="400" /></a></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>Dussehra </b>(Vijaya Dashami, Dasara, or Dashain) is a Hindu festival that celebrates the victory of good over evil.Dasara means Vijayadashami, means remover of bad fate.It is one of the important festival in India.It is also said as Dashera, Dussera and Dussehra in North India.In Nepal, it termed as Dashain while in Himachal Pradesh, Kullu Dussehra.<br />
<br />
Dusara has background stories from Ramayana and Mahabharata times.<br />
<br />
Dussehra celebrates the Hindu god Rama's victory over the demon king Ravana and the triumph of good over evil. The epic Ramayana tells the story of the Lord Rama who wins the lovely Sita for his wife, only to have her carried off by Ravana, the demon king of Lanka.<br />
<br />
Ravana plays an important role in the <b>Ramayana</b>. Ravana had a sister known as Shoorpanakha. She fell in love with the brothers Rama and Lakshamana and wanted to marry one of them. Lakshamana refused to marry her and Rama could not as he was already married to Sita.<br />
<br />
Shoorpanakha threatened to kill Sita, so that she could marry Rama. This angered Lakshamana who cut off Shoorpanakha's nose and ears. Ravana then kidnapped Sita to avenge his sister's injuries. Rama and Lakshamana later fought a battle to rescue Sita. The monkey god Hanuman and a huge army of monkeys helped them.<br />
<br />
The <b>Mahabharata </b>is another series of Hindu stories that play a role in the Dussehra festival. The Pandavas were five brothers who fought evil forces with a set of distinctive weapons. They abandoned their weapons and went into exile for one year. They hid their weapons in a Shami tree and found them at the same place when they returned from exile. They then worshipped the tree before going to a battle, which they won. This epic is also commemorated during Dussehra.<br />
<br />
To celebrate Dasara occasion , people do puja of household and work-related tools, such as books, computers, cooking pans and vehicles in the state of Karnataka.Performance of Ramlila happens in all parts of India specially in North part of India.<br />
<br />
Many Hindus also believe that it is lucky to start a new venture, project or journey on Dussehra. They may also exchange gifts of leaves from the Shami tree (Prosopis spicigera) as a symbol of the story of the Pandavas brothers' exile in the Mahabharata stories.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
The city of Mysore has a long tradition of celebrating the Dasara festival and the festivities there are an elaborate affair, attracting a large audience including foreigners. The Dasara festival completed 400th anniversary in year 2010.The main attraction of the ten-day Mysore Dasara festival is the Mysore Palace which is illuminated daily with nearly 1 lakh (100,000) light bulbs from 7 pm to 10 pm on all days of the festival. The traditional Dasara procession (locally known as Jumboo Savari) is held on the streets of Mysore city.</div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com2tag:blogger.com,1999:blog-2751949949822608152.post-14087015429351904472015-09-18T02:43:00.002-07:002016-05-08T22:43:03.238-07:00Mantra Pushpanjali<div dir="ltr" style="text-align: left;" trbidi="on">
<div style="text-align: justify;">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEj-b2YKY20uUnf3u0ntBY-GtRHJC89GiYHlIGVrz_tFIp71y2LAjrhVoF7EF5mGuRey74i1dxehvDZdngjWEziEt-bB9YLVyJ4tVGwkYN4IHVJXi7A2g4_qjrlga9GML6q0z2wWJfK5ZeI/s1600/mantrapushpa1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="277" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEj-b2YKY20uUnf3u0ntBY-GtRHJC89GiYHlIGVrz_tFIp71y2LAjrhVoF7EF5mGuRey74i1dxehvDZdngjWEziEt-bB9YLVyJ4tVGwkYN4IHVJXi7A2g4_qjrlga9GML6q0z2wWJfK5ZeI/s400/mantrapushpa1.jpg" width="400" /></a></div>
<b><br /></b>
<b>Mantra Pushpanjali </b>(मंत्रपुष्पांजलि) is a popular prayer in Maharashtra, and it means “a prayer with an offering of flowers”. It comprises four hymns from Vedic sources, and is the final prayer sung at the end of Aartis.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
During the Ganesh Festival, <b>Mantra Pushpanjali </b>is sung after the Aartis.Unlike the āratis and the bhajan, Mantrapushpanjali is not accompanied by clapping or by hand cymbals. Mantrapushpanjali is enunciated reverentially by devotees holding flowers in their palms. After the recitation, the flowers are offered to the Ganesh idol.</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: justify;">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgDY1E30lxPP_dBvNPMCr-W_J3bUVzmPCoq0NFcI2LUu0hBLHIWgK5GSRfUmNwAElNUg4WDYcEXO1w2pBfhJYaDvMLfaxEzWXDcapZf5BpUgO4TpdGagsZZL4Ndtb4Xwdu0WJLpu-sMzgk/s1600/mantra1.png" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="300" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgDY1E30lxPP_dBvNPMCr-W_J3bUVzmPCoq0NFcI2LUu0hBLHIWgK5GSRfUmNwAElNUg4WDYcEXO1w2pBfhJYaDvMLfaxEzWXDcapZf5BpUgO4TpdGagsZZL4Ndtb4Xwdu0WJLpu-sMzgk/s400/mantra1.png" width="400" /></a></div>
<br /></div>
<div style="text-align: center;">
ॐ यज्ञेन यज्ञमयजंत देवास्तानि धर्माणि प्रथमान्यासन्|<br />
ते हं नाकं महिमान: सचंत यत्र पूर्वे साध्या: संति देवा:<br />
ॐ राजाधिराजाय प्रसह्ये साहिने | नमो वयं वैश्रवणाय कुर्महे<br />
स मे कामान्कामकामाय मह्यम्| कामेश्वरो वैश्रवणो ददातु|<br />
कुबेराय वैश्रवणाय | महाराजाय नम: ॐ स्वस्ति<br />
साम्राज्यं भौज्यं स्वाराज्यं वैराज्यं पारमेष्ठ्यं राज्यं माहाराज्यमाधिपत्यमयं समंतपर्यायी<br />
स्यात्सार्वभौम: सार्वायुष आंतादापरार्धात्पृथिव्यै समुद्रपर्यंता या एकराळिति<br />
तदप्येष श्लोकोऽभिगीतो मरुत: परिवेष्टारो मरुत्तस्यावसन्गृहे<br />
आविक्षितस्य कामप्रेर्विश्वेदेवा: सभासद इति</div>
<h2 style="text-align: center;">
<b><span style="font-size: x-large;">Meaning of Mantrapushpanjali </span></b></h2>
<div style="text-align: justify;">
यज्ञेन यज्ञमयजन्त देवास्तानि धर्माणि प्रथमान्यासन् | ते ह नाकं महिमानः सचन्त यत्र पूर्वे साध्याः सन्ति देवाः || 1 ||</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
By means of sacrifice the Gods accomplished their sacrifice: these were the earliest ordinances. These Mighty Ones attained the height of heaven, there where the Sādhyas, Gods of old, are dwelling.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
राजाधिराजाय प्रसह्यसाहिने नमो वयं वैश्रवणाय कुर्महे | स मे कामान्कामकामाय मह्यम् कामेश्वरो वैश्रवणो ददातु | कुबेराय वैश्रवणाय महाराजाय नमः || 2 ||</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
We bow to Rājādhirāja Prasahyasāhī Vaiśravaṇa. May he, Kāmeshvara Vaiśravaṇa, grant me my desires for enjoyment of pleasures. [We] bow to Mahārāja Vaiśravaṇa Kubera.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
साम्राज्यं भौज्यं स्वाराज्यं वैराज्यं पारमेष्ठ्यं राज्यं माहाराज्यमाधिपत्यमयं समंतपर्यायी स्यात्सार्वभौमः सार्वायुष आंतादापरार्धात्पृथिव्यै समुद्रपर्यंताया एकराळिति || 3 ||</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
... Universal sovereignty, enjoyment (of pleasures), independence, distinguished distinction as a king, the fulfilment of the highest desires, the position of a king, of a great king, and supreme mastership, that he might cross (with his arms) the universe, and become the ruler of the whole earth during all his life, which may last for an infinitely long time, that he might be the sole king of the earth up to its shores bordering on the ocean.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
तदप्येषः श्लोको ऽभिगीतो | मरुतः परिवेष्टारो मरुत्तस्यावसन् गृहे | आविक्षितस्य कामप्रेर्विश्वे देवाः सभासद इति ||4||</div>
<div style="text-align: justify;">
Regarding this event there is the following Stotra chanted: “The Maruts resided as the distributors of food in the house of Marutta, the son of Avikshit, who had fulfilled all his desires; all the gods were present at the gathering.”</div>
<h3 style="text-align: center;">
Translation in English</h3>
<div style="text-align: justify;">
Om yajnena yajnamayajanta devaastani dharmani prathamaanyaasan |</div>
<div style="text-align: justify;">
Te ha naakam mahimanah sachanta yatra purve sadhyahsanti devah ||</div>
<div style="text-align: justify;">
Om raajaadhiraajaaya prasahyasaahine | namo vayam vaishravanaaya kurmahe</div>
<div style="text-align: justify;">
Sa me kaamaan kaamakaamaaya mahyamkameshwaro vaishravano dadatu |</div>
<div style="text-align: justify;">
Kuberaya vaishravanaya mahaarajaaya namah |</div>
<div style="text-align: justify;">
Om swasti samrajyam bhoujyam swaraajyam</div>
<div style="text-align: justify;">
Vairaajyam paarameshthyam raajyam mahaaraajyamadahipatyamayam</div>
<div style="text-align: justify;">
Samaamtaparyaeesyat saarvabhoumah saarvaayusha aantaadaaparaardhat |</div>
<div style="text-align: justify;">
Pruthivyaisamudraparyantaayaa ekaraaliti | </div>
<div style="text-align: justify;">
tadapyeshashloko bhigito marutah </div>
<div style="text-align: justify;">
pariveshtaaro maruttasyaa vasan gruhe | avikshitasyakaamaprervishvedevaah sabhaasada iti |</div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-58337471091260701852015-09-09T03:04:00.003-07:002015-09-09T03:04:38.631-07:00Devichi Aarti<div dir="ltr" style="text-align: left;" trbidi="on">
<div dir="ltr" style="text-align: left;" trbidi="on">
<div style="text-align: justify;">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhAym5p_5gPkc4JL5lDd0TXrCDdzK486VRQLNz08NHRQuuq97pWrt64LzlANQIkWDFppeufG5wzfHNkaMMRIfGm3cMpQ4cgQPLe6e2ExjIceX_eEFd6Lb1T43GsZGzWfDNjaCeM36vhXe0/s1600/durga+mata1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="225" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhAym5p_5gPkc4JL5lDd0TXrCDdzK486VRQLNz08NHRQuuq97pWrt64LzlANQIkWDFppeufG5wzfHNkaMMRIfGm3cMpQ4cgQPLe6e2ExjIceX_eEFd6Lb1T43GsZGzWfDNjaCeM36vhXe0/s400/durga+mata1.jpg" width="400" /></a></div>
<br />
Devichi Aarti ,Aarti of Goddess Durga, in Marathi Language.Durga mata means Bhavani mata in Maharashtra.For any Goddess occasion, if we don't know any specific Aarti, this is very common Aarti to be sung for Puja after Ganapati Aarti.<br />
<br />
You can check on <a href="https://www.youtube.com/watch?v=BilNvAY5f7g" target="_blank">youtube videos</a> to listen as well as buy <a href="http://www.amazon.com/gp/product/B00MJD4LYW/ref=as_li_tl?ie=UTF8&camp=1789&creative=390957&creativeASIN=B00MJD4LYW&linkCode=as2&tag=httppshinde2h-20&linkId=IJRI6X5T6FDF5BMP" target="_blank">online CD for Durge Durgat Bhari</a> also.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
दुर्गे दुर्घट भारी तुजवीण संसारी </div>
<div style="text-align: center;">
अनाथ नाथे अंबे करुणा विस्तारी </div>
<div style="text-align: center;">
वारी वारी जन्म मरण तेवारी </div>
<div style="text-align: center;">
हारी पडलो आता संकट नेवारी</div>
<div style="text-align: center;">
जय देवी जय देवी जय महिषासुर मर्दिनी </div>
<div style="text-align: center;">
सुरवर ईश्वर वरदे तारक संजीवनी </div>
<div style="text-align: center;">
जय देवी जय देवी</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
तुजवीण भुवनी पाहत तुज ऐसे नाही </div>
<div style="text-align: center;">
चारी श्रमले परंतु न बोलवे काही </div>
<div style="text-align: center;">
साही विवाद करिता पडिलो प्रवाही </div>
<div style="text-align: center;">
ते तू भक्ता लागे ते तू दस लागे पावस लवलाही </div>
<div style="text-align: center;">
जय देवी जय देवी जय महिषासुर मर्दिनी </div>
<div style="text-align: center;">
सुरवर ईश्वर वरदे तारक संजीवनी </div>
<div style="text-align: center;">
जय देवी जय देवी</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
प्रसन्न वदने प्रसन्न होशी निजदासा </div>
<div style="text-align: center;">
क्लेशांपासून तोडी होई भोपाषा </div>
<div style="text-align: center;">
आंबे तुजवाचून कोण पुरवी आशा </div>
<div style="text-align: center;">
नरहर तल्लीन झाला पद पंकज लेशा</div>
<div style="text-align: center;">
जय देवी जय देवी जय महिषासुर मर्दिनी </div>
<div style="text-align: center;">
सुरवर ईश्वर वरदे तारक संजीवनी </div>
<div style="text-align: center;">
जय देवी जय देवी</div>
<div style="text-align: center;">
<b><br /></b>
<b>Translation in English</b></div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Durge durghat bhari tujvin sansari II</div>
<div style="text-align: center;">
Anathnathe ambe karuna vistari II</div>
<div style="text-align: center;">
Vari vari janam marante vari II</div>
<div style="text-align: center;">
Hari padalo ata sankat nivari II 1 II</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Jaya devi jaya devi mahisha surmathini II</div>
<div style="text-align: center;">
Survar ishwar varde tarak sanjivani II Dhr. II</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Tujaveen bhuvani pahata tuj aise nahi II</div>
<div style="text-align: center;">
Chari shramale parantu n bolve kahi II</div>
<div style="text-align: center;">
Sahi vivad karita padile pravahi II</div>
<div style="text-align: center;">
Te tu bhaktalagi pavasi lavlahi II 2 II</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Prasanna vadane prasanna hosi nijdasa II</div>
<div style="text-align: center;">
Kleshapasuni sodivi todi bhavpasha II</div>
<div style="text-align: center;">
Ambe tujvachun kon purvil asha II</div>
<div style="text-align: center;">
Narhari tallin jhala padpankajlesha II 3 II<br />
<br /></div>
</div>
<iframe frameborder="0" marginheight="0" marginwidth="0" scrolling="no" src="//ws-na.amazon-adsystem.com/widgets/q?ServiceVersion=20070822&OneJS=1&Operation=GetAdHtml&MarketPlace=US&source=ss&ref=ss_til&ad_type=product_link&tracking_id=httppshinde2h-20&marketplace=amazon&region=US&placement=B00MJD4LYW&asins=B00MJD4LYW&linkId=2D3UUUT5QDFRMAN3&show_border=true&link_opens_in_new_window=true" style="height: 240px; width: 120px;">
</iframe><iframe frameborder="0" marginheight="0" marginwidth="0" scrolling="no" src="//ws-na.amazon-adsystem.com/widgets/q?ServiceVersion=20070822&OneJS=1&Operation=GetAdHtml&MarketPlace=US&source=ss&ref=ss_til&ad_type=product_link&tracking_id=httppshinde2h-20&marketplace=amazon&region=US&placement=B00CAM01XW&asins=B00CAM01XW&linkId=6JBBMWPXYSVC5TFD&show_border=true&link_opens_in_new_window=true" style="height: 240px; width: 120px;">
</iframe><iframe frameborder="0" marginheight="0" marginwidth="0" scrolling="no" src="//ws-na.amazon-adsystem.com/widgets/q?ServiceVersion=20070822&OneJS=1&Operation=GetAdHtml&MarketPlace=US&source=ss&ref=ss_til&ad_type=product_link&tracking_id=httppshinde2h-20&marketplace=amazon&region=US&placement=B00TPYF4CG&asins=B00TPYF4CG&linkId=L5OIZ3RXOQZF3LSL&show_border=true&link_opens_in_new_window=true" style="height: 240px; width: 120px;">
</iframe></div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-31702510652851281652015-09-07T03:06:00.001-07:002016-06-06T04:24:52.913-07:00Shri Ganapati Aarti<div dir="ltr" style="text-align: left;" trbidi="on">
<div dir="ltr" style="text-align: left;" trbidi="on">
<div dir="ltr" style="text-align: left;" trbidi="on">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjHwn24QXxDCL_g0WP7p0MxBZh128FDHAnSGNFgIOwly7owN1X3anwOo3_z5fggfJpnQFo3PzySwKj96TsVghfRAljNpyTfGh_iF-sxUichOtbNpaZe1gLJNodyOKxP91kEFoia1FwapS0/s1600/ganapati1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="298" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjHwn24QXxDCL_g0WP7p0MxBZh128FDHAnSGNFgIOwly7owN1X3anwOo3_z5fggfJpnQFo3PzySwKj96TsVghfRAljNpyTfGh_iF-sxUichOtbNpaZe1gLJNodyOKxP91kEFoia1FwapS0/s400/ganapati1.jpg" width="400" /></a></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<b>Lord Ganesh</b> is the favorite god of lot people in India. From small kids to elders all are true worshipers of Ganpati. Bal Ganesh stories are popular among all kids and inspire them to do good.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Traditionally Lord Ganesha, son of Mahadev Shiva, is worshipped first among all Gods. Lord Ganesha bestows wisdom and removes all obstacles which might come while performing auspicious work. Hence Lord Ganesha is worshiped first while starting all Pujas and auspicious activities.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Ganapati or Ganesh's most famous Aarti in Maharashtra. On any festival or Puja , Ganapati Aarti is started first to invoke blessings of Ganapati.</div>
<h2 style="text-align: center;">
<span style="font-size: x-large;">Sukhakarta Dukhaharta Aarti</span></h2>
<br />
<div style="text-align: center;">
सुखकर्ता दुखहर्ता वार्ता विघ्नाची |</div>
<div style="text-align: center;">
नुरवी पूर्वी प्रेम कृपा जयाची |</div>
<div style="text-align: center;">
सर्वांगी सुंदर उटी शेंदुराची |</div>
<div style="text-align: center;">
कंठी झरके माल मुक्ताफळाची || १ ||</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
जय देव जय देव जय मंगलमूर्ती |</div>
<div style="text-align: center;">
दर्शनमात्रे मनकामना पुरती || </div>
<div style="text-align: center;">
रत्नखचित फरा तूज गौरीकुमरा |</div>
<div style="text-align: center;">
चंदनाची उटी कुंकुमकेशरा |</div>
<div style="text-align: center;">
हिरे जडित मुकुट शोभतो बरा |</div>
<div style="text-align: center;">
रुणझुणती नुपुरे चरणी घागरिया || 2 ||</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
लंबोदर पितांबर फनी वरवंदना |</div>
<div style="text-align: center;">
सरळ सोंड वक्रतुंड त्रिनयना |</div>
<div style="text-align: center;">
दास रामाचा वाट पाहे सदना |</div>
<div style="text-align: center;">
संकटी पावावे निर्वाणी रक्षावे सुरवंदना |</div>
<div style="text-align: center;">
जय देव जय देव जय मंगलमूर्ती |</div>
<div style="text-align: center;">
दर्शनमात्रे मनकामना पुरती || ३ ||</div>
<br />
<h3 style="text-align: center;">
Translation in English</h3>
<br />
<div style="text-align: center;">
Sukhkarta Dukhharta Varta Vighnachi</div>
<div style="text-align: center;">
Nurvi Purvi Prem Krupa Jayachi </div>
<div style="text-align: center;">
Sarvangi Sundar Uti Shendurachi </div>
<div style="text-align: center;">
Kanti Jhalke Mal Mukataphalaanchi </div>
<div style="text-align: center;">
Jai dev jai dev </div>
<div style="text-align: center;">
Jai mangal murti</div>
<div style="text-align: center;">
Darshan marte maan kamana purti</div>
<div style="text-align: center;">
Jai dev jai dev </div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Ratnakhachit Phara Tujh Gaurikumra</div>
<div style="text-align: center;">
Chandanaachi Uti Kumkum ke shara </div>
<div style="text-align: center;">
Hire jadit Mukut Shobhato Bara </div>
<div style="text-align: center;">
Runjhunati Nupure Charani Ghagriya</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Jai dev jai dev </div>
<div style="text-align: center;">
Jai mangal murti</div>
<div style="text-align: center;">
Darshan marte maan kamana purti</div>
<div style="text-align: center;">
Jai dev jai dev </div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Lambodar Pitaambar Phanivar vandana</div>
<div style="text-align: center;">
Saral Sond Vakratunda Trinayana </div>
<div style="text-align: center;">
Das Ramacha Vat Pahe Sadna</div>
<div style="text-align: center;">
Sankati Pavave Nirvani Rakshave Survar vandana </div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Jai dev jai dev 2</div>
<div style="text-align: center;">
Jai mangal murti</div>
<div style="text-align: center;">
Darshan marte maan kamana purti</div>
<div style="text-align: center;">
Jai dev jai dev </div>
<br />
<h2 style="text-align: left;">
Meaning:</h2>
<br />
<b>Sukhkarta Dukhharta Varta Vighnachi |</b><br />
Oh Lord who provides Joy, takes away Sadness and removes all “vighnas” (obstacles) in life<br />
<br />
<b>Nurvi Purvi Prem Krupa Jayachi |</b><br />
Who spreads love everywhere as his blessing<br />
<br />
<b>Sarvangi Sundar Uti Shendurachi |</b><br />
Who has lovely “shendur utna”(yellow-orange fragrance paste) all over his body<br />
<br />
<b>Kanti Jhalke Mal Mukataphalaanchi |</b><br />
Who has a necklace of “Mukataphal”(pearls in Sanskrit) around his neck<br />
<br />
<b>Jaidev Jaidev Jai Mangal Murti |</b><br />
Hail the god, Hail the god, Hail the auspicious idol<br />
<br />
<b>Darshan Maatre Man: Kaamna Purti |</b><br />
All our wishes are fulfilled just by “darshan” (looking at the idol<br />
<br />
<b>Ratnakhachit Phara Tujh Gaurikumra |</b><br />
Offering you Seat studded with Ratna(jewels) for you “Gaurikumra” (son of Gauri)<br />
<br />
<b>Chandanaachi Uti Kumkumkeshara |</b><br />
Smearing you with Chandan(Sandalwood) utna(paste) and Kumkum(Red Tilak) on the head<br />
<br />
<b>Hirejadit Mukut Shobhato Bara |</b><br />
Diamond studded crown suites you right<br />
<br />
<b>Runjhunati Nupure(2) Charani Ghagriya |</b><br />
Whose anklets tingle in his feet<br />
<br />
<b>Jaidev…</b><br />
<b>Lambodar Pitaambar Phanivarabandhana |</b><br />
<br />
Lambodar Who wears Pitaambar(yellow cloth worn by men during puja)<br />
“Lambodar” – from the long – ‘lambo’, tummy – ‘udar’<br />
<br />
<b>Saral Sond Vakratunda Trinayana |</b><br />
Who has Straight trunk and is Vakratunda and Trinayana<br />
“Vakratunda”one who breaks the ego of he who behaves anti-socially (’Vakra’).<br />
“Trinayana” the son of the 3 eyed (Lord Shiva)<br />
<br />
<b>Das Ramacha Vat Pahe Sadana |</b><br />
I am waiting for you in my “Sadana” (home) just like the slave(used as devotee) of Lord Rama<br />
<br />
<b>Sankati Pavave Nirvani Rakshave |</b><br />
Please help us and protect us during bad times<br />
<br />
<b>Survarvandana |</b><br />
Salutations<br />
<div>
<br /></div>
</div>
<iframe frameborder="0" marginheight="0" marginwidth="0" scrolling="no" src="//ws-na.amazon-adsystem.com/widgets/q?ServiceVersion=20070822&OneJS=1&Operation=GetAdHtml&MarketPlace=US&source=ss&ref=ss_til&ad_type=product_link&tracking_id=httppshinde2h-20&marketplace=amazon&region=US&placement=B0052ZP9Y0&asins=B0052ZP9Y0&linkId=EGBPMXFWB6LN3GQA&show_border=true&link_opens_in_new_window=true" style="height: 240px; width: 120px;">
</iframe>
<iframe frameborder="0" marginheight="0" marginwidth="0" scrolling="no" src="//ws-na.amazon-adsystem.com/widgets/q?ServiceVersion=20070822&OneJS=1&Operation=GetAdHtml&MarketPlace=US&source=ss&ref=ss_til&ad_type=product_link&tracking_id=httppshinde2h-20&marketplace=amazon&region=US&placement=B00LKQT3LA&asins=B00LKQT3LA&linkId=PZMNB6IDOTF7BXGT&show_border=true&link_opens_in_new_window=true" style="height: 240px; width: 120px;">
</iframe><iframe frameborder="0" marginheight="0" marginwidth="0" scrolling="no" src="//ws-na.amazon-adsystem.com/widgets/q?ServiceVersion=20070822&OneJS=1&Operation=GetAdHtml&MarketPlace=US&source=ss&ref=ss_til&ad_type=product_link&tracking_id=httppshinde2h-20&marketplace=amazon&region=US&placement=B006DHVH0G&asins=B006DHVH0G&linkId=CHWHQE2OGBLLEGZZ&show_border=true&link_opens_in_new_window=true" style="height: 240px; width: 120px;">
</iframe></div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0tag:blogger.com,1999:blog-2751949949822608152.post-42762928411139183902015-09-04T03:06:00.003-07:002015-09-06T03:30:47.208-07:00Narali Poornima | Rakshabandhan<div dir="ltr" style="text-align: left;" trbidi="on">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjzkbMUurSnIv8QMF3k-3IssQfnVYEpVAk-F1ZVWWC1lLGpNzMmg4SeQpjG95y-7igXFWHU_d2hy4p4kqEQW-cgGgOnm5AF5nXGYh926mVMKOlXwb8Kp7qBX6qg8e-9ESOJ9Xk6oobeDPk/s1600/narali+pournima1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="238" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjzkbMUurSnIv8QMF3k-3IssQfnVYEpVAk-F1ZVWWC1lLGpNzMmg4SeQpjG95y-7igXFWHU_d2hy4p4kqEQW-cgGgOnm5AF5nXGYh926mVMKOlXwb8Kp7qBX6qg8e-9ESOJ9Xk6oobeDPk/s400/narali+pournima1.jpg" width="400" /></a></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Narali Purnima or Rakhi Pournima takes place in Maharasthra & Kerala.It is also called as Coconut Day festival.The Hindu festival of Narali Purnima or the Coconut festival is celebrated with great fervor and in a jubilant manner by the fishermen and the fishing community in Maharashtra on the full moon day of Shravan. 'Shravan' is one out of the four most auspicious months in the Hindu calendar. Thus, a full moon day or the Purnima in this month is regarded as even more sacred.<br />
<div style="-webkit-text-stroke-width: 0px; color: black; font-family: 'Times New Roman'; font-size: medium; font-style: normal; font-variant: normal; font-weight: normal; letter-spacing: normal; line-height: normal; orphans: auto; text-align: justify; text-indent: 0px; text-transform: none; white-space: normal; widows: 1; word-spacing: 0px;">
<div style="margin: 0px;">
<br /></div>
</div>
It also marks the end of monsoon, and is primarily observed by sailors, fishermen and others living in the coastal areas of South India. They offer coconut to the sea on this occasion.The word 'Naral' means coconut and coconut is offered to the sea on the full moon day, hence the name Narali Purnima. Other names for the festival include Shravani Purnima, Raksha Bandhan and Rakhi Purnima.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Narial (naral in Marathi) which means coconuts, are offered to the sea god Varuna, to seek his blessings for a fruitful fishing season, hence the name Narali Purnima comes into the picture. It is believed that an offering of gold coconut to the sea will bring in a lot of luck but since it is a very costly affair many do not follow it.Dancing and singing are an integral part of this festival. The traditional food includes sweet coconut rice which is savored with curry.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
The reason for offering no other fruit but the coconut is because coconut has long been regarded as an auspicious offering Gods in all Hindu festivals. This is because every part of the tree – leaves, bark, coconut itself is extremely useful to man. Thus, this offering of coconut is believed to appease the Sea god for a safe journey ahead in the waters. </div>
<div style="text-align: justify;">
<br /></div>
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgkGYixyjjeGnx8CpOLQSlPSeOLdtNHG-3Y9fyxDOK6IfOIIutAOr_Hbew1d-KvYRYkdLZDfrP_0pkYud301o5E_rwc6yBwcBLQMoL_aGoV3ZCl1uZQuy1GH7xYtUhF2Q34UFTKC4F1ANs/s1600/rakshabandhan1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="278" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgkGYixyjjeGnx8CpOLQSlPSeOLdtNHG-3Y9fyxDOK6IfOIIutAOr_Hbew1d-KvYRYkdLZDfrP_0pkYud301o5E_rwc6yBwcBLQMoL_aGoV3ZCl1uZQuy1GH7xYtUhF2Q34UFTKC4F1ANs/s400/rakshabandhan1.jpg" width="400" /></a></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
The festival of <b>Rakshabandhan </b>is also celebrated on the Poornima of month of Shravan. Rakshabandhan is a festival of Rakhi or Raksha thread. Normally, sisters tie Rakhi on the wrist of their brothers. They tie Rakhi and perform their Aarti. Brothers give the word of protection to their sisters in return and also give them some gifts.</div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com1tag:blogger.com,1999:blog-2751949949822608152.post-47269953957994789492015-09-02T03:21:00.002-07:002016-05-08T22:43:20.378-07:00Morning Shlokas for kids<div dir="ltr" style="text-align: left;" trbidi="on">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg3z_iuxUUn5Uh78w_OAeABzRRMpsCYRVl2RCBOSGhKXIE25ZvMPaFMikMn_stlFxwdQBMfw7FfBuhCXjBaYbVj_P3yhLhFgtKAV9cYHLJeo2QpGZGoWR3Bgb2qtxy19ean1lySeS8FT0I/s1600/morning1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" height="400" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg3z_iuxUUn5Uh78w_OAeABzRRMpsCYRVl2RCBOSGhKXIE25ZvMPaFMikMn_stlFxwdQBMfw7FfBuhCXjBaYbVj_P3yhLhFgtKAV9cYHLJeo2QpGZGoWR3Bgb2qtxy19ean1lySeS8FT0I/s400/morning1.jpg" width="400" /></a></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Hindu scriptures are written mostly in Sanskrit language. Compilation of Sanskrit words is known as ‘Shloka‘. Among all written Shlokas, some are regularly recited by Hindus. one we chanted during our school days as prayers, some are morning Shlokas. </div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Early Morning is considered as the best time to worship God. Early morning is also known as
"Brahma Mahurat" in the Hindu Mythology. It is regarded that prayers made at this time reach
directly to the God. Early <b><a href="http://www.amazon.com/gp/product/B006DI0XCI/ref=as_li_tl?ie=UTF8&camp=1789&creative=390957&creativeASIN=B006DI0XCI&linkCode=as2&tag=httppshinde2h-20&linkId=QGEQAAB6VDBWHMMY" target="_blank">Morning Shloka</a></b> is given here which also serves as the first prayer of
the day to the almighty.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
This shloka is to be recited in the morning. When you get up, just sit in the bed, don't rush out to get ready. Say this shloka with eyes still closed, and open them by the fourth part and see your hands and smile. </div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
Some even says there is science behind it, As per <a href="http://blog.practicalsanskrit.com/2009/07/force-is-in-your-hands.html">Practicalsanskrit.com</a>,this exercise helps to stabilize your blood pressure. Aafter lying for 6-7 hours, you suddenly get up, there can be a pressure drop in the brain and this is known to be the most important factor in early morning strokes. Morning shlokas take about 1-2 minutes which is enough to get your brain used to new blood pressure.</div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: justify;">
<br /></div>
<div style="text-align: center;">
<b>कराग्रे वसते लक्ष्मी, करमध्ये सरस्वती ।</b></div>
<div style="text-align: center;">
<b>करमूले स्थिता गौरी, मंगलं करदर्शनम् ॥</b></div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
karAgre vasate lakShmI, kara-madhye saraswatI |</div>
<div style="text-align: center;">
kara-moole sthitA gaurI, mangalaM* kara-darshanaM ||</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
Lakshmi in the finger tips, Saraswati on the palm |</div>
<div style="text-align: center;">
Shakti is situated in the wrist, it is auspicious to see the Hands ||</div>
<div style="text-align: center;">
<br /></div>
<div style="text-align: center;">
<br /></div>
</div>
Anonymoushttp://www.blogger.com/profile/09078973202026388232noreply@blogger.com0